SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.
close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 38.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

1ilevel : 1056964 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1056964.2 1056964.2 845.0 / 0.080% 163093.1 / 15.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
1ilevel 1056964
Earth Shock 109315 10.4% 16.5 17.51sec 1988986 2055034 Direct 16.5 1405476 3888955 1988954 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9679 0.0000 32792181.31 32792181.31 0.00 2055034.24 2055034.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.61 76.50% 1405475.69 1139446 1675140 1405872.82 1264462 1553325 17727176 17727176 0.00
crit 3.87 23.50% 3888954.84 3153985 4636788 3838886.84 0 4636788 15065006 15065006 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63352 (96824) 6.0% (9.2%) 22.1 13.76sec 1314021 991385 Direct 22.0 611434 1692239 861738 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3254 0.0000 18995192.02 18995192.02 0.00 991384.54 991384.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.94 76.84% 611434.48 523267 683116 611568.94 569064 652379 10357095 10357095 0.00
crit 5.10 23.16% 1692239.24 1448404 1890864 1687805.46 0 1890864 8638097 8638097 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33471 3.2% 13.9 21.23sec 719399 0 Direct 13.9 513642 1421265 720947 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.92 0.00 0.00 0.0000 0.0000 10035521.33 10035521.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.74 77.16% 513641.67 439545 573817 513713.59 449333 564001 5516606 5516606 0.00
crit 3.18 22.84% 1421264.65 1216660 1588326 1373972.80 0 1588326 4518916 4518916 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61666 5.8% 11.2 27.77sec 1647149 1717876 Direct 11.2 92322 256048 130175 23.1%  
Periodic 236.3 51141 141534 72047 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.33 236.33 0.9589 1.2619 18487777.70 18487777.70 0.00 59834.29 1717875.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.63 76.88% 92322.38 78137 102006 92311.73 80457 100377 796706 796706 0.00
crit 2.59 23.12% 256047.99 216282 282352 241114.55 0 282352 664353 664353 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.7 76.87% 51141.17 37 56104 51144.32 47395 53033 9291000 9291000 0.00
crit 54.7 23.13% 141534.43 254 155296 141544.81 128467 147970 7735720 7735720 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123439 11.7% 38.3 7.54sec 964900 1009528 Direct 38.3 681260 1887082 964934 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.34 38.34 0.00 0.00 0.9558 0.0000 36996185.30 36996185.30 0.00 1009528.35 1009528.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.32 76.48% 681260.21 467488 772770 681628.78 638166 729905 19976519 19976519 0.00
crit 9.02 23.52% 1887081.54 1638501 2139027 1885297.56 0 2139027 17019666 17019666 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35317 (54204) 3.3% (5.1%) 9.7 32.13sec 1677763 1318465 Direct 9.7 774211 2140441 1096038 23.6%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.66 0.00 0.00 1.2725 0.0000 10588772.84 10588772.84 0.00 1318465.25 1318465.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.39 76.45% 774210.56 665924 869351 774262.83 673339 846548 5718373 5718373 0.00
crit 2.28 23.55% 2140440.73 1843278 2406364 1971191.52 0 2406364 4870400 4870400 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18886 1.8% 6.2 47.37sec 917793 0 Direct 6.2 649870 1800272 920068 23.5%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.15 0.00 0.00 0.0000 0.0000 5662629.78 5662629.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.71 76.51% 649869.64 559376 730255 648433.81 0 730255 3059882 3059882 0.00
crit 1.45 23.49% 1800271.74 1548354 2021346 1415307.87 0 2021346 2602747 2602747 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156645 (245271) 14.8% (23.2%) 59.0 5.03sec 1246306 1067997 Direct 58.9 0 797781 797781 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.02 58.88 0.00 0.00 1.1670 0.0000 46975471.10 46975471.10 0.00 1067996.57 1067996.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.88 100.00% 797780.79 695280 907675 797848.04 765577 833710 46975471 46975471 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80459 7.6% 37.6 7.86sec 642436 0 Direct 37.4 0 644508 644508 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.44 0.00 0.00 0.0000 0.0000 24133143.66 24133143.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.44 100.00% 644507.72 561738 733337 644554.79 607637 678724 24133144 24133144 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8167 0.8% 44.0 6.17sec 55710 0 Direct 44.0 44872 91543 55709 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.97 43.97 0.00 0.00 0.0000 0.0000 2449648.92 2449648.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.76 76.78% 44872.17 43108 48099 44883.42 43204 48099 1514896 1514896 0.00
crit 10.21 23.22% 91543.28 87940 98122 91520.57 0 98122 934753 934753 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122974 (225141) 11.6% (21.3%) 97.2 3.01sec 694380 577616 Direct 97.2 238012 662814 379237 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.19 97.19 0.00 0.00 1.2022 0.0000 36859275.08 36859275.08 0.00 577615.69 577615.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.88 66.76% 238011.87 154866 606522 238303.13 197529 283114 15442714 15442714 0.00
crit 32.31 33.24% 662813.93 428668 1678852 663112.12 485949 935342 21416562 21416562 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 102167 9.7% 94.6 3.76sec 323840 0 Direct 94.6 203366 566046 323842 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.58 94.58 0.00 0.00 0.0000 0.0000 30629920.05 30629920.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.17 66.78% 203366.03 130087 509478 203396.93 158613 263796 12845750 12845750 0.00
crit 31.42 33.22% 566045.85 360081 1410235 566051.84 408241 885172 17784170 17784170 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59298) 0.0% (5.6%) 3.0 120.39sec 5921876 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.57 0.00 0.0000 1.0000 0.00 0.00 0.00 306750.66 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 18929 1.8% 37.4 6.99sec 150561 0 Direct 37.3 121869 248614 151196 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.44 37.28 0.00 0.00 0.0000 0.0000 5637327.86 5637327.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.66 76.86% 121869.49 121869 121869 121869.49 121869 121869 3492173 3492173 0.00
crit 8.63 23.14% 248613.77 248614 248614 248560.96 0 248614 2145155 2145155 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40369 3.8% 98.4 2.61sec 122184 0 Direct 98.1 98655 201256 122509 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.39 98.13 0.00 0.00 0.0000 0.0000 12022001.00 12022001.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.32 76.75% 98654.92 98655 98655 98654.92 98655 98655 7430670 7430670 0.00
crit 22.81 23.25% 201256.04 201256 201256 201256.04 201256 201256 4591331 4591331 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 144613 / 55212
Fire Blast 144613 5.2% 62.7 4.31sec 262517 147225 Direct 62.7 213051 426110 262518 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.68 62.68 0.00 0.00 1.7831 0.0000 16453557.35 16453557.35 0.00 147224.87 147224.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.12 76.78% 213051.32 199777 222910 213046.85 208206 220119 10253012 10253012 0.00
crit 14.55 23.22% 426109.67 399554 445820 426100.95 411417 445820 6200545 6200545 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 187184 / 26594
Lightning Blast 187184 2.5% 41.9 6.70sec 189870 203113 Direct 41.9 154154 308308 189874 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.93 41.93 0.00 0.00 0.9348 0.0000 7961207.99 7961207.99 0.00 203112.77 203112.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.21 76.83% 154154.36 147983 165119 154186.45 149631 162837 4966063 4966063 0.00
crit 9.71 23.17% 308307.73 295966 330237 308367.40 295966 330237 2995145 2995145 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
1ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0333 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:1ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.57sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8215 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.23sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.22 0.00 0.00 0.00 0.5224 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.77% 8.77% 0.0(0.0) 3.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.77%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.3sec 23.7sec 34.78% 34.78% 1.4(1.4) 10.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.86% 34.86% 1.4(1.4) 10.2

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.88% 33.88% 1.8(1.8) 9.9

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.3 4.1sec 2.9sec 60.68% 63.25% 30.3(36.3) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.60%
  • elemental_focus_2:35.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.28% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.35%
  • icefury_2:5.86%
  • icefury_3:4.93%
  • icefury_4:3.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.3 13.0sec 12.2sec 10.28% 39.68% 1.3(1.3) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.28%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.61% 13.61% 0.0(0.0) 3.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.61%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.0sec 0.0sec 39.86% 39.86% 0.0(0.0) 1.7

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.3sec 21.70% 23.98% 1.4(2.9) 0.1

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.18%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:9.25%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.79% 0.0(0.0) 0.3

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.23%
  • stormkeeper_2:3.68%
  • stormkeeper_3:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:1ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 78.6sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6800.0014.2662.4500.0009.360
Fire Elemental0.3390.0011.2480.0910.0001.248
Lava Burst0.8990.0018.4397.3140.00027.513
Elemental Blast0.5310.0014.8598.8182.28818.847
Icefury0.9880.0018.7047.1960.56621.627

Resources

Resource Usage Type Count Total Average RPE APR
1ilevel
earth_shock Maelstrom 134.3 16110.7 120.0 977.2 2035.4
flame_shock Maelstrom 91.4 1634.6 17.9 145.6 11310.1
frost_shock Maelstrom 312.3 6245.6 20.0 162.9 5923.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 480.71 5705.70 (23.36%) 11.87 62.83 1.09%
Lava Burst Overload Maelstrom 305.96 2654.51 (10.87%) 8.68 99.14 3.60%
Lightning Bolt Maelstrom 791.54 6315.73 (25.85%) 7.98 16.59 0.26%
Lightning Bolt Overload Maelstrom 770.26 4568.17 (18.70%) 5.93 53.37 1.15%
Icefury Maelstrom 78.89 1882.36 (7.71%) 23.86 11.03 0.58%
Icefury Overload Maelstrom 50.25 895.25 (3.66%) 17.82 9.26 1.02%
Resonance Totem Maelstrom 2430.73 2408.05 (9.86%) 0.99 22.69 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.15 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 1ilevel Fight Length
Count 9415
Mean 300.00
Minimum 239.95
Maximum 360.04
Spread ( max - min ) 120.09
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.7794
5th Percentile 245.37
95th Percentile 354.60
( 95th Percentile - 5th Percentile ) 109.23
Mean Distribution
Standard Deviation 0.3790
95.00% Confidence Intervall ( 299.26 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 578
0.1% Error 57737
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 47
0.01 Scale Factor Error with Delta=300 1155
DPS
Sample Data 1ilevel Damage Per Second
Count 9415
Mean 1056964.21
Minimum 914112.52
Maximum 1236560.37
Spread ( max - min ) 322447.85
Range [ ( max - min ) / 2 * 100% ] 15.25%
Standard Deviation 41834.1785
5th Percentile 989253.90
95th Percentile 1127376.07
( 95th Percentile - 5th Percentile ) 138122.17
Mean Distribution
Standard Deviation 431.1427
95.00% Confidence Intervall ( 1056119.18 - 1057809.23 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6018
0.1 Scale Factor Error with Delta=300 14939848
0.05 Scale Factor Error with Delta=300 59759390
0.01 Scale Factor Error with Delta=300 1493984730
Priority Target DPS
Sample Data 1ilevel Priority Target Damage Per Second
Count 9415
Mean 1056964.21
Minimum 914112.52
Maximum 1236560.37
Spread ( max - min ) 322447.85
Range [ ( max - min ) / 2 * 100% ] 15.25%
Standard Deviation 41834.1785
5th Percentile 989253.90
95th Percentile 1127376.07
( 95th Percentile - 5th Percentile ) 138122.17
Mean Distribution
Standard Deviation 431.1427
95.00% Confidence Intervall ( 1056119.18 - 1057809.23 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6018
0.1 Scale Factor Error with Delta=300 14939848
0.05 Scale Factor Error with Delta=300 59759390
0.01 Scale Factor Error with Delta=300 1493984730
DPS(e)
Sample Data 1ilevel Damage Per Second (Effective)
Count 9415
Mean 1056964.21
Minimum 914112.52
Maximum 1236560.37
Spread ( max - min ) 322447.85
Range [ ( max - min ) / 2 * 100% ] 15.25%
Damage
Sample Data 1ilevel Damage
Count 9415
Mean 292265047.95
Minimum 209688284.59
Maximum 377914428.77
Spread ( max - min ) 168226144.18
Range [ ( max - min ) / 2 * 100% ] 28.78%
DTPS
Sample Data 1ilevel Damage Taken Per Second
Count 9415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 1ilevel Healing Per Second
Count 9415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 1ilevel Healing Per Second (Effective)
Count 9415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 1ilevel Heal
Count 9415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 1ilevel Healing Taken Per Second
Count 9415
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 1ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 1ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 1ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.05 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.05 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.32 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.45 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.72 elemental_blast
Keep your EB always on Cooldown.
I 12.61 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.51 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.96 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.69 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.59 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.80 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.17 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.27 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.07 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.20 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.97 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMMNNNSNSSSMOSHMSSSISMSSSSSMISHMMSSKNNNNMMORHRRSMPSSSSMHSSJSIMKNMNHMNNOSSSMMSSHISMSMSSSMHIKMNMMNFMNNHMMMQRRIMAJMMHSSMSIKNSFMMHNNSNMRRRSSHMIMOSMRKNNHNMNRRMIRMMHRJLLIMMOSSSSHKMGNNNSMRRM97IHMMRMSOSMPSHSSMKMGMNN8MHNMSSAMIJSOSSSHMMSSSISSSKMHMNMNNNRRRMIMSHSSSSOMSSSHMIKMNNMN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 1ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.958 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.720 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.737 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.501 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.263 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.042 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.819 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.598 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.377 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.156 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.934 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.969 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.728 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:14.483 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.240 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.996 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:16.751 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.507 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:18.264 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:19.018 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:19.773 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:20.530 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:21.288 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.042 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.799 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:23.554 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.311 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:25.068 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:26.007 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:26.948 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:28.199 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:29.453 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:30.349 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:31.545 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:32.763 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.799 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.991 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:35.770 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:36.547 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:37.326 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:38.106 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.885 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.921 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.739 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.826 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.209 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.592 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.230 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.549 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.558 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.906 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.254 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.599 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.944 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.357 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.742 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:59.126 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.509 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.548 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.585 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.623 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.005 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.390 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:07.429 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:08.469 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
1:09.508 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:11.147 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:12.467 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:13.459 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
1:14.449 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:15.441 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:16.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:17.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:18.744 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:19.735 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.056 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.402 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.812 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.223 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.284 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.697 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.079 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.463 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.502 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.885 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.295 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.706 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.116 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.631 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.692 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.103 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:42.162 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:43.222 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:44.633 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:45.692 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:46.753 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:47.812 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:48.872 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:49.909 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
1:50.949 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:52.331 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.369 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:54.754 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.813 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.565 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.977 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.387 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.447 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.858 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.858 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.919 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.978 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.037 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.448 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.507 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.567 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.979 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.040 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.100 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.511 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:14.573 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:15.983 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:17.042 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:18.102 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:19.514 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:20.926 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:21.987 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:23.048 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:24.460 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:25.519 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.931 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.341 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.725 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.106 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.488 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.871 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.257 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.669 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.729 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.789 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.848 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.260 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.671 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.083 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:45.468 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
2:46.507 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
2:47.545 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:48.929 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:49.968 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:51.352 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:52.412 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.822 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.234 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.294 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.354 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.766 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.825 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.235 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.644 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.991 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.001 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.011 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.021 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.032 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.044 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.393 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.149 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.903 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:12.840 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:13.822 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:14.804 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:15.767 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:16.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
3:17.603 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
3:18.358 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, mark_of_the_claw
3:19.113 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw
3:19.868 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw
3:20.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:21.562 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:22.318 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:23.255 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:24.840 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:26.028 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:27.217 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:27.217 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
3:28.463 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
3:30.124 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:31.312 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.659 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:34.005 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:34.997 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:36.317 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:37.309 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:38.630 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:39.951 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:40.942 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.355 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:43.738 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:45.058 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:46.378 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:47.700 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:49.047 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
3:50.056 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
3:51.065 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
3:52.076 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:53.086 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:54.096 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:54.851 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:56.262 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:57.674 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:58.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.695 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.043 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:02.390 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:02.390 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.735 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.747 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:05.751 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:06.506 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:07.261 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:08.014 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:08.769 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:09.731 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:10.693 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:11.447 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:12.366 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:13.285 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:14.221 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:15.158 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:15.913 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:16.851 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:18.436 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:20.018 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:21.601 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, potion_of_prolonged_power
4:23.262 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, potion_of_prolonged_power
4:24.922 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:25.932 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:26.942 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
4:28.288 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:29.042 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:29.795 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:30.550 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:31.486 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:32.403 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:33.322 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:34.075 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:34.830 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:35.748 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:36.711 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:37.900 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:38.882 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:39.817 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:41.400 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:42.983 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:44.170 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:45.755 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:47.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:48.920 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.302 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.676 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.669 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:56.311 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:57.322 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.332 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.344 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81663 81663 44193
Intellect 58940 56709 46683 (20870)
Spirit 0 0 0
Health 4899780 4899780 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58940 56709 0
Crit 20.31% 20.31% 6125
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7245
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 955, weapon: { 4382 - 8141, 2.6 }, stats: { +1552 Int, +2329 Sta, +442 Crit, +424 Mastery, +19759 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 955, stats: { +2038 Int, +3057 Sta, +580 Crit, +557 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="1ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=955
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.75
# gear_stamina=44193
# gear_intellect=46683
# gear_crit_rating=6125
# gear_haste_rating=11779
# gear_mastery_rating=7245
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

2ilevel : 1061217 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1061216.6 1061216.6 848.1 / 0.080% 162650.3 / 15.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
2ilevel 1061217
Earth Shock 109715 10.4% 16.5 17.52sec 1995847 2061377 Direct 16.5 1410314 3909104 1995812 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9683 0.0000 32916069.48 32916069.48 0.00 2061377.10 2061377.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.63 76.57% 1410313.87 1143795 1680871 1410828.30 1265661 1546003 17809161 17809161 0.00
crit 3.86 23.43% 3909104.46 3166026 4652652 3848162.68 0 4652652 15106909 15106909 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63521 (97171) 6.0% (9.2%) 22.1 13.75sec 1318587 994742 Direct 22.0 613725 1697935 863892 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.05 0.00 0.00 1.3256 0.0000 19045584.23 19045584.23 0.00 994741.86 994741.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 76.93% 613725.31 525265 685453 613847.54 560105 652370 10409095 10409095 0.00
crit 5.09 23.07% 1697934.99 1453933 1897333 1694969.52 0 1897333 8636489 8636489 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33650 3.2% 14.0 21.27sec 723365 0 Direct 13.9 515558 1427181 725155 23.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.92 0.00 0.00 0.0000 0.0000 10094383.84 10094383.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.72 77.01% 515558.31 441223 575780 515626.14 466186 564328 5527518 5527518 0.00
crit 3.20 22.99% 1427181.38 1221304 1593760 1375918.91 0 1593760 4566866 4566866 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61927 5.8% 11.2 27.78sec 1654897 1724371 Direct 11.2 92680 257073 131217 23.4%  
Periodic 236.3 51344 142101 72353 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.26 236.26 0.9597 1.2622 18566304.83 18566304.83 0.00 60089.02 1724371.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.59 76.56% 92679.72 78435 102355 92675.87 83308 100726 796089 796089 0.00
crit 2.63 23.44% 257072.89 217108 283318 243835.35 0 283318 675950 675950 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.6 76.85% 51344.19 34 56296 51347.77 46818 53065 9322293 9322293 0.00
crit 54.7 23.15% 142101.16 101 155828 142103.62 130156 148235 7771973 7771973 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123804 11.7% 38.3 7.53sec 967584 1012700 Direct 38.3 683581 1893876 967575 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.34 38.34 0.00 0.00 0.9555 0.0000 37100250.24 37100250.24 0.00 1012699.61 1012699.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.35 76.53% 683580.59 401087 775414 683929.96 644609 730656 20060334 20060334 0.00
crit 9.00 23.47% 1893876.05 1644756 2146345 1892485.24 1644756 2146345 17039916 17039916 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35450 (54458) 3.3% (5.1%) 9.7 32.12sec 1683873 1323855 Direct 9.7 776791 2154514 1099446 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2720 0.0000 10627566.63 10627566.63 0.00 1323855.11 1323855.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.58% 776791.39 668466 872325 776935.71 668466 854975 5749932 5749932 0.00
crit 2.26 23.42% 2154513.61 1850315 2414597 1992267.19 0 2414597 4877635 4877635 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19008 1.8% 6.2 46.51sec 922344 0 Direct 6.2 652958 1806980 924796 23.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.16 0.00 0.00 0.0000 0.0000 5694243.05 5694243.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.71 76.44% 652957.82 561512 732753 652428.58 0 732753 3073391 3073391 0.00
crit 1.45 23.56% 1806980.44 1554264 2028261 1431122.64 0 2028261 2620852 2620852 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 157712 (247016) 14.9% (23.3%) 59.2 5.02sec 1250926 1072520 Direct 59.1 0 800750 800750 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.21 59.06 0.00 0.00 1.1664 0.0000 47289125.91 47289125.91 0.00 1072519.55 1072519.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.06 100.00% 800750.19 697935 910780 800832.88 768813 836913 47289126 47289126 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81105 7.6% 37.7 7.82sec 644833 0 Direct 37.6 0 646831 646831 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.71 37.59 0.00 0.00 0.0000 0.0000 24316419.34 24316419.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.59 100.00% 646830.85 563882 735846 646900.38 610800 688659 24316419 24316419 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8199 0.8% 44.0 6.21sec 55892 0 Direct 44.0 45037 91877 55893 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.00 44.00 0.00 0.00 0.0000 0.0000 2459437.26 2459437.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.81 76.82% 45036.56 43272 48263 45048.29 43272 47361 1522471 1522471 0.00
crit 10.20 23.18% 91877.20 88276 98457 91894.89 88276 98457 936966 936966 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 123114 (225459) 11.6% (21.3%) 97.0 3.01sec 696621 579255 Direct 97.0 239054 665096 380342 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.01 97.01 0.00 0.00 1.2026 0.0000 36894390.20 36894390.20 0.00 579255.32 579255.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.84 66.84% 239053.77 155457 608597 239336.71 199136 280995 15500020 15500020 0.00
crit 32.17 33.16% 665095.98 430304 1684596 665535.59 493038 968859 21394370 21394370 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 102345 9.7% 94.4 3.78sec 325063 0 Direct 94.4 204457 567336 325060 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.39 94.39 0.00 0.00 0.0000 0.0000 30681535.04 30681535.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.02 66.76% 204456.99 130584 511221 204582.36 156811 263579 12884461 12884461 0.00
crit 31.37 33.24% 567335.62 361456 1415060 567461.55 408962 850447 17797074 17797074 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59420) 0.0% (5.6%) 3.0 120.38sec 5934350 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.71 0.00 0.0000 1.0000 0.00 0.00 0.00 306645.44 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19025 1.8% 37.6 6.97sec 150692 0 Direct 37.4 121869 248614 151298 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.59 37.44 0.00 0.00 0.0000 0.0000 5665199.64 5665199.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.75 76.78% 121869.49 121869 121869 121869.49 121869 121869 3503536 3503536 0.00
crit 8.69 23.22% 248613.77 248614 248614 248586.73 0 248614 2161664 2161664 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40395 3.8% 98.6 2.62sec 122044 0 Direct 98.3 98655 201256 122354 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.57 98.32 0.00 0.00 0.0000 0.0000 12030082.04 12030082.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.61 76.90% 98654.92 98655 98655 98654.92 98655 98655 7459561 7459561 0.00
crit 22.71 23.10% 201256.04 201256 201256 201256.04 201256 201256 4570521 4570521 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 144994 / 55547
Fire Blast 144994 5.2% 62.8 4.31sec 263430 147596 Direct 62.8 213796 427574 263433 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.85 62.85 0.00 0.00 1.7848 0.0000 16555298.35 16555298.35 0.00 147596.40 147596.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.25 76.78% 213795.98 200540 223673 213796.18 209095 220676 10316539 10316539 0.00
crit 14.59 23.22% 427573.55 401079 447346 427562.60 415908 447346 6238759 6238759 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 188018 / 26700
Lightning Blast 188018 2.5% 41.9 6.73sec 190602 203963 Direct 41.9 154711 309550 190601 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.93 41.93 0.00 0.00 0.9345 0.0000 7991048.09 7991048.09 0.00 203962.53 203962.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.21 76.82% 154710.72 148548 165684 154741.84 149447 161905 4982905 4982905 0.00
crit 9.72 23.18% 309550.04 297096 331367 309639.65 297096 331367 3008143 3008143 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
2ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0350 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:2ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.57sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8208 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.08sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5215 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.1sec 32.13% 32.13% 3.1(3.1) 8.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.0sec 69.0sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.6sec 34.96% 34.96% 1.4(1.4) 10.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.87% 34.87% 1.4(1.4) 10.2

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.0sec 23.6sec 33.78% 33.78% 1.7(1.7) 9.9

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.3 4.1sec 2.9sec 60.71% 63.32% 30.3(36.3) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.63%
  • elemental_focus_2:35.09%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.36%
  • icefury_2:5.87%
  • icefury_3:4.94%
  • icefury_4:3.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.4 1.4 12.9sec 12.2sec 10.36% 39.91% 1.4(1.4) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.92% 29.92% 4.2(4.2) 12.6

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.4sec 69.4sec 13.54% 13.54% 0.0(0.0) 3.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.54%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.1sec 0.0sec 39.84% 39.84% 0.0(0.0) 1.7

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.5sec 30.2sec 21.82% 24.06% 1.4(2.9) 0.1

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.20%
  • power_of_the_maelstrom_2:6.32%
  • power_of_the_maelstrom_3:9.30%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.53% 8.81% 0.0(0.0) 0.3

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.70%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:2ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.8 12.2sec
Lava Surge: Wasted 1.4 78.5sec
Lava Surge: During Lava Burst 3.7 57.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6800.0014.2522.4550.0009.586
Fire Elemental0.3460.0011.2490.0930.0001.249
Lava Burst0.8940.0018.5247.3340.00023.972
Elemental Blast0.5310.0014.0618.8102.35417.956
Icefury0.9880.0017.5937.2110.26422.252

Resources

Resource Usage Type Count Total Average RPE APR
2ilevel
earth_shock Maelstrom 133.7 16047.4 120.0 973.0 2051.2
flame_shock Maelstrom 91.0 1626.1 17.9 144.9 11417.4
frost_shock Maelstrom 310.9 6218.8 20.0 162.2 5965.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 480.14 5699.62 (23.43%) 11.87 62.10 1.08%
Lava Burst Overload Maelstrom 305.78 2651.08 (10.90%) 8.67 100.97 3.67%
Lightning Bolt Maelstrom 786.63 6276.34 (25.80%) 7.98 16.71 0.27%
Lightning Bolt Overload Maelstrom 765.38 4538.81 (18.66%) 5.93 53.49 1.16%
Icefury Maelstrom 78.61 1874.99 (7.71%) 23.85 11.53 0.61%
Icefury Overload Maelstrom 50.06 891.68 (3.66%) 17.81 9.44 1.05%
Resonance Totem Maelstrom 2420.24 2397.43 (9.85%) 0.99 22.81 0.94%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 51.96 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 2ilevel Fight Length
Count 9196
Mean 300.00
Minimum 239.93
Maximum 360.04
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.0214
5th Percentile 245.31
95th Percentile 354.69
( 95th Percentile - 5th Percentile ) 109.38
Mean Distribution
Standard Deviation 0.3756
95.00% Confidence Intervall ( 299.26 - 300.73 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 554
0.1% Error 55384
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1108
DPS
Sample Data 2ilevel Damage Per Second
Count 9196
Mean 1061216.58
Minimum 934491.68
Maximum 1230803.84
Spread ( max - min ) 296312.16
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 41493.7581
5th Percentile 994575.88
95th Percentile 1132476.07
( 95th Percentile - 5th Percentile ) 137900.20
Mean Distribution
Standard Deviation 432.6964
95.00% Confidence Intervall ( 1060368.51 - 1062064.65 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5873
0.1 Scale Factor Error with Delta=300 14697695
0.05 Scale Factor Error with Delta=300 58790778
0.01 Scale Factor Error with Delta=300 1469769433
Priority Target DPS
Sample Data 2ilevel Priority Target Damage Per Second
Count 9196
Mean 1061216.58
Minimum 934491.68
Maximum 1230803.84
Spread ( max - min ) 296312.16
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 41493.7581
5th Percentile 994575.88
95th Percentile 1132476.07
( 95th Percentile - 5th Percentile ) 137900.20
Mean Distribution
Standard Deviation 432.6964
95.00% Confidence Intervall ( 1060368.51 - 1062064.65 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5873
0.1 Scale Factor Error with Delta=300 14697695
0.05 Scale Factor Error with Delta=300 58790778
0.01 Scale Factor Error with Delta=300 1469769433
DPS(e)
Sample Data 2ilevel Damage Per Second (Effective)
Count 9196
Mean 1061216.58
Minimum 934491.68
Maximum 1230803.84
Spread ( max - min ) 296312.16
Range [ ( max - min ) / 2 * 100% ] 13.96%
Damage
Sample Data 2ilevel Damage
Count 9196
Mean 293380591.73
Minimum 213046079.24
Maximum 383163470.19
Spread ( max - min ) 170117390.94
Range [ ( max - min ) / 2 * 100% ] 28.99%
DTPS
Sample Data 2ilevel Damage Taken Per Second
Count 9196
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 2ilevel Healing Per Second
Count 9196
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 2ilevel Healing Per Second (Effective)
Count 9196
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 2ilevel Heal
Count 9196
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 2ilevel Healing Taken Per Second
Count 9196
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 2ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 2ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 2ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.00 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.19 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.31 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.20 elemental_blast
Keep your EB always on Cooldown.
I 12.33 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.40 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.74 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.60 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.37 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.03 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.03 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.16 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.77 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.97 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGMGMGMOHSSPSSSMMSSSPMHMSSSSSKGMGMGMGMHOSSISMSSSHMSPSJMMSKMGHMGGNMFSSSSHIMSSSMSSMHKGGMGNORRMMHIQRSMSSSAJSHMIMKNNMNNFMHSMSSSSIMSHSSSMSOKGNNHMNSSSMIMSSMHSSMMIJSSMSOMSHKGGMGNSSSPHMM97SSMSSIMHMQSOKNNMNNSHSSMSSASIJSMHMSOSSMRKGNHMGMNRRIMSSHMOMSSSPSMSHKNMMMNNN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 2ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.961 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.048 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.135 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.221 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.038 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.855 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:08.671 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:09.426 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:10.181 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:10.934 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:11.688 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:12.442 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:13.196 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.953 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:14.708 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.714 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:16.472 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.226 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.981 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:18.735 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:19.489 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:20.246 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:21.001 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:22.220 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:23.439 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:24.657 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:25.874 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:26.791 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:27.750 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:29.029 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.118 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.204 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:31.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:32.718 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:33.475 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:34.231 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:34.987 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
0:35.742 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:36.496 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:37.251 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:38.005 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:38.759 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:39.513 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:40.269 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.026 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:41.988 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:42.743 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:43.661 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:45.216 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:46.381 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:47.937 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:49.489 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:51.072 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:52.655 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.066 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.478 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.890 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.302 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.360 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.772 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.832 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.891 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.303 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.364 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:07.838 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.896 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:10.307 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:11.690 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:12.728 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:13.767 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:14.805 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.188 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.249 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.659 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.071 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.484 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.896 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.307 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.368 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:26.781 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:28.164 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:29.547 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:30.930 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.315 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:33.699 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:35.081 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:36.120 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.714 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.060 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:40.069 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:41.080 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:42.425 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:43.436 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:44.446 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.456 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.801 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.148 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.208 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.620 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.004 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.042 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.796 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:55.182 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:56.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.979 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.803 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.213 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.213 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.272 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.332 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.743 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.154 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.164 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.174 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:10.521 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:11.532 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:12.543 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:13.890 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:14.900 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:15.912 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.923 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.981 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:19.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.803 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.148 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.494 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.842 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:26.187 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.532 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.542 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.890 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:31.274 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:32.772 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.091 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.413 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.760 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.107 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.454 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.465 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.863 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:42.874 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:43.933 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:44.991 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:46.401 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:47.784 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:48.823 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.205 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.588 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.972 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.030 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.090 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:56.072 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:57.054 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:58.035 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:58.791 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:59.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:00.756 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.739 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:02.492 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:03.475 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.230 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.984 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:05.738 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:06.492 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:07.247 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:08.493 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:09.740 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:11.403 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:13.063 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:14.724 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:16.310 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:17.319 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:18.329 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:19.649 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:20.641 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:21.632 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.953 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.272 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.617 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.675 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.129 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.540 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.598 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.656 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.656 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:33.067 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:34.452 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:35.837 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:37.222 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:38.606 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:39.646 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:40.706 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.119 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:43.531 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:44.285 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:45.606 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:46.596 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:47.915 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:48.907 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:49.899 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:51.219 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:52.209 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
3:53.199 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:54.582 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:55.967 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:57.351 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.697 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.044 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.367 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.688 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.688 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.008 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.001 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.991 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:06.983 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.042 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.454 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.800 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.809 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:12.821 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:13.832 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:15.180 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:16.527 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:17.874 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:19.260 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:20.271 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:21.330 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:22.860 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:23.920 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:24.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
4:26.393 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
4:27.453 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.865 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:30.277 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:31.336 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:32.748 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.160 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.570 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.983 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.042 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.101 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.483 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.250 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.633 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.672 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.082 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.904 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.318 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.665 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:53.674 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:54.686 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:55.696 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:57.043 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.053 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.064 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81741 81741 44242
Intellect 59165 56934 46898 (20870)
Spirit 0 0 0
Health 4904460 4904460 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59165 56934 0
Crit 20.32% 20.32% 6128
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.77% 58.77% 7249
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 956, weapon: { 4423 - 8216, 2.6 }, stats: { +1567 Int, +2350 Sta, +443 Crit, +426 Mastery, +19940 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 956, stats: { +2057 Int, +3085 Sta, +582 Crit, +559 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="2ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=956
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.88
# gear_stamina=44242
# gear_intellect=46898
# gear_crit_rating=6128
# gear_haste_rating=11779
# gear_mastery_rating=7249
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

3ilevel : 1065060 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1065059.8 1065059.8 851.9 / 0.080% 162563.2 / 15.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
3ilevel 1065060
Earth Shock 109923 10.3% 16.5 17.51sec 2000586 2065065 Direct 16.5 1415538 3918365 2000715 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.9688 0.0000 32970826.35 32970826.35 0.00 2065064.91 2065064.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.63 76.62% 1415537.92 1148435 1686985 1415989.70 1244531 1573514 17875716 17875716 0.00
crit 3.85 23.38% 3918364.81 3178868 4669573 3863168.12 0 4669573 15095110 15095110 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63795 (97650) 6.0% (9.2%) 22.1 13.76sec 1325368 999777 Direct 22.0 616105 1705613 868033 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.04 0.00 0.00 1.3257 0.0000 19131284.12 19131284.12 0.00 999776.68 999776.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.94 76.88% 616104.83 527396 687946 616229.40 574768 653243 10439109 10439109 0.00
crit 5.10 23.12% 1705612.60 1459831 1904234 1698665.44 0 1904234 8692175 8692175 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33855 3.2% 14.0 20.94sec 725508 0 Direct 14.0 517505 1432990 727415 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.96 0.00 0.00 0.0000 0.0000 10153174.72 10153174.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.07% 517505.45 443012 577874 517616.95 452800 560124 5566956 5566956 0.00
crit 3.20 22.93% 1432989.75 1226258 1599556 1386476.81 0 1599556 4586218 4586218 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 62166 5.8% 11.2 27.75sec 1661144 1730732 Direct 11.2 93041 257890 131170 23.1%  
Periodic 236.2 51531 142627 72681 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.17 236.17 0.9598 1.2627 18636520.26 18636520.26 0.00 60315.68 1730731.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 76.87% 93041.32 78753 102727 93025.93 82650 99307 802359 802359 0.00
crit 2.60 23.13% 257889.61 217988 284348 244123.48 0 284348 669319 669319 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.3 76.78% 51530.85 40 56501 51532.81 47892 53459 9344864 9344864 0.00
crit 54.8 23.22% 142626.84 100 156394 142634.04 129388 148631 7819979 7819979 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 124727 11.7% 38.4 7.54sec 974225 1019426 Direct 38.4 686641 1900554 974199 23.7%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 0.9557 0.0000 37379275.41 37379275.41 0.00 1019425.52 1019425.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.28 76.31% 686641.20 542975 778234 687049.92 639936 728216 20103599 20103599 0.00
crit 9.09 23.69% 1900553.69 1635569 2154151 1899397.12 1666022 2154151 17275677 17275677 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35625 (54727) 3.3% (5.1%) 9.7 32.12sec 1691645 1329689 Direct 9.7 780024 2158637 1103475 23.5%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.68 0.00 0.00 1.2723 0.0000 10677274.14 10677274.14 0.00 1329688.78 1329688.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.54% 780023.69 671178 875498 780135.88 686007 849473 5776491 5776491 0.00
crit 2.27 23.46% 2158637.23 1857820 2423379 1994890.43 0 2423379 4900783 4900783 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 19102 1.8% 6.2 47.29sec 926936 0 Direct 6.2 655209 1813658 929133 23.6%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.16 0.00 0.00 0.0000 0.0000 5727096.34 5727096.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.71 76.35% 655208.68 563789 735418 654055.68 0 735418 3083305 3083305 0.00
crit 1.46 23.65% 1813657.62 1560569 2035638 1434196.17 0 2035638 2643791 2643791 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 158146 (247737) 14.9% (23.3%) 59.1 5.03sec 1256217 1076367 Direct 59.0 0 803843 803843 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.14 59.00 0.00 0.00 1.1671 0.0000 47423097.52 47423097.52 0.00 1076367.20 1076367.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.00 100.00% 803842.68 700766 914093 803916.05 770690 842977 47423098 47423098 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81354 7.6% 37.7 7.83sec 647284 0 Direct 37.6 0 649255 649255 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.57 0.00 0.00 0.0000 0.0000 24393465.17 24393465.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.57 100.00% 649254.94 566169 738522 649338.29 609139 687163 24393465 24393465 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8237 0.8% 44.1 6.15sec 56046 0 Direct 44.1 45206 92231 56047 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.07 44.07 0.00 0.00 0.0000 0.0000 2469995.66 2469995.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.91 76.95% 45205.60 43448 48439 45215.26 43448 47258 1532958 1532958 0.00
crit 10.16 23.05% 92231.42 88634 98815 92214.28 0 98815 937037 937037 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 123628 (226419) 11.6% (21.3%) 97.0 3.01sec 699759 581765 Direct 97.0 240091 666891 382053 33.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.98 96.98 0.00 0.00 1.2028 0.0000 37051848.59 37051848.59 0.00 581764.56 581764.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.72 66.74% 240090.54 156087 610810 240368.91 191324 284907 15538657 15538657 0.00
crit 32.26 33.26% 666890.54 432050 1690722 667177.25 493980 978881 21513192 21513192 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 102791 9.7% 94.3 3.77sec 326617 0 Direct 94.3 204920 570566 326614 33.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.33 94.33 0.00 0.00 0.0000 0.0000 30809242.09 30809242.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.93 66.72% 204919.91 131113 513080 204997.27 152706 260087 12896470 12896470 0.00
crit 31.39 33.28% 570566.35 362922 1420207 570728.17 407114 877729 17912772 17912772 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59318) 0.0% (5.5%) 3.0 120.39sec 5929478 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.57 0.00 0.0000 1.0000 0.00 0.00 0.00 306815.40 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19014 1.8% 37.6 6.98sec 150721 0 Direct 37.4 121869 248614 151316 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.41 0.00 0.00 0.0000 0.0000 5660629.15 5660629.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.72 76.77% 121869.49 121869 121869 121869.49 121869 121869 3499954 3499954 0.00
crit 8.69 23.23% 248613.77 248614 248614 248532.87 0 248614 2160675 2160675 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40304 3.8% 98.3 2.62sec 122130 0 Direct 98.0 98655 201256 122444 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.28 98.03 0.00 0.00 0.0000 0.0000 12003040.49 12003040.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.30 76.82% 98654.92 98655 98655 98654.92 98655 98655 7428940 7428940 0.00
crit 22.73 23.18% 201256.04 201256 201256 201256.04 201256 201256 4574100 4574100 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 145480 / 55610
Fire Blast 145480 5.2% 62.7 4.31sec 264453 148105 Direct 62.7 214633 429276 264453 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.67 62.67 0.00 0.00 1.7856 0.0000 16573090.48 16573090.48 0.00 148104.94 148104.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.12 76.79% 214633.22 201353 224486 214628.31 209837 221773 10328968 10328968 0.00
crit 14.55 23.21% 429276.00 402706 448973 429281.26 417959 448973 6244122 6244122 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 188620 / 26783
Lightning Blast 188620 2.5% 41.9 6.72sec 191350 204581 Direct 41.9 155322 310610 191349 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.89 41.89 0.00 0.00 0.9353 0.0000 8015490.27 8015490.27 0.00 204581.17 204581.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.17 76.80% 155321.83 149150 166286 155357.95 150798 163723 4996720 4996720 0.00
crit 9.72 23.20% 310610.21 298301 332572 310701.11 298301 332572 3018771 3018771 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
3ilevel
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0337 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.60sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.8217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.15sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.21 0.00 0.00 0.00 0.5220 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.1sec 32.07% 32.07% 3.1(3.1) 7.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.7sec 69.7sec 8.63% 8.63% 0.0(0.0) 3.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.63%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.5 27.0sec 23.4sec 35.09% 35.09% 1.5(1.5) 10.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:35.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.85% 34.85% 1.4(1.4) 10.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.1sec 23.6sec 33.75% 33.75% 1.8(1.8) 9.9

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.1 30.2 4.1sec 2.9sec 60.74% 63.35% 30.2(36.3) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:35.10%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.35%
  • icefury_2:5.88%
  • icefury_3:4.93%
  • icefury_4:3.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.32% 39.77% 1.4(1.4) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.32%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 70.0sec 70.0sec 13.43% 13.43% 0.0(0.0) 3.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.43%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.0sec 0.0sec 39.86% 39.86% 0.0(0.0) 1.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.7sec 30.4sec 21.64% 23.91% 1.4(2.9) 0.1

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.27%
  • power_of_the_maelstrom_3:9.19%

Trigger Attempt Success

  • trigger_pct:14.94%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.53% 8.81% 0.0(0.0) 0.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.29%
  • stormkeeper_2:3.69%
  • stormkeeper_3:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.2sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 77.6sec
Lava Surge: During Lava Burst 3.7 57.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6810.0014.3132.4570.0009.719
Fire Elemental0.3540.0021.2490.0930.0001.249
Lava Burst0.8930.0019.9287.2520.00026.734
Elemental Blast0.5330.0014.3378.8532.54116.964
Icefury0.9830.0018.4217.1760.60822.574

Resources

Resource Usage Type Count Total Average RPE APR
3ilevel
earth_shock Maelstrom 135.9 16305.5 120.0 989.4 2022.1
flame_shock Maelstrom 92.5 1654.1 17.9 147.4 11266.6
frost_shock Maelstrom 316.4 6328.2 20.0 164.9 5906.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 487.67 5789.73 (23.41%) 11.87 62.34 1.07%
Lava Burst Overload Maelstrom 310.77 2695.18 (10.90%) 8.67 101.76 3.64%
Lightning Bolt Maelstrom 799.74 6381.07 (25.80%) 7.98 16.88 0.26%
Lightning Bolt Overload Maelstrom 777.91 4613.32 (18.65%) 5.93 54.14 1.16%
Icefury Maelstrom 79.97 1907.37 (7.71%) 23.85 11.96 0.62%
Icefury Overload Maelstrom 50.95 907.89 (3.67%) 17.82 9.22 1.01%
Resonance Totem Maelstrom 2461.26 2438.38 (9.86%) 0.99 22.88 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.74 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 3ilevel Fight Length
Count 9220
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.7113
5th Percentile 244.78
95th Percentile 355.20
( 95th Percentile - 5th Percentile ) 110.42
Mean Distribution
Standard Deviation 0.3823
95.00% Confidence Intervall ( 299.25 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 576
0.1% Error 57526
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 47
0.01 Scale Factor Error with Delta=300 1151
DPS
Sample Data 3ilevel Damage Per Second
Count 9220
Mean 1065059.84
Minimum 925887.72
Maximum 1234273.08
Spread ( max - min ) 308385.36
Range [ ( max - min ) / 2 * 100% ] 14.48%
Standard Deviation 41737.7522
5th Percentile 998837.67
95th Percentile 1134959.29
( 95th Percentile - 5th Percentile ) 136121.63
Mean Distribution
Standard Deviation 434.6739
95.00% Confidence Intervall ( 1064207.89 - 1065911.78 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5900
0.1 Scale Factor Error with Delta=300 14871056
0.05 Scale Factor Error with Delta=300 59484221
0.01 Scale Factor Error with Delta=300 1487105503
Priority Target DPS
Sample Data 3ilevel Priority Target Damage Per Second
Count 9220
Mean 1065059.84
Minimum 925887.72
Maximum 1234273.08
Spread ( max - min ) 308385.36
Range [ ( max - min ) / 2 * 100% ] 14.48%
Standard Deviation 41737.7522
5th Percentile 998837.67
95th Percentile 1134959.29
( 95th Percentile - 5th Percentile ) 136121.63
Mean Distribution
Standard Deviation 434.6739
95.00% Confidence Intervall ( 1064207.89 - 1065911.78 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5900
0.1 Scale Factor Error with Delta=300 14871056
0.05 Scale Factor Error with Delta=300 59484221
0.01 Scale Factor Error with Delta=300 1487105503
DPS(e)
Sample Data 3ilevel Damage Per Second (Effective)
Count 9220
Mean 1065059.84
Minimum 925887.72
Maximum 1234273.08
Spread ( max - min ) 308385.36
Range [ ( max - min ) / 2 * 100% ] 14.48%
Damage
Sample Data 3ilevel Damage
Count 9220
Mean 294486770.00
Minimum 208505879.53
Maximum 381833187.11
Spread ( max - min ) 173327307.58
Range [ ( max - min ) / 2 * 100% ] 29.43%
DTPS
Sample Data 3ilevel Damage Taken Per Second
Count 9220
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 3ilevel Healing Per Second
Count 9220
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 3ilevel Healing Per Second (Effective)
Count 9220
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 3ilevel Heal
Count 9220
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 3ilevel Healing Taken Per Second
Count 9220
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 3ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 3ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 3ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.01 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.99 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.21 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.36 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.25 elemental_blast
Keep your EB always on Cooldown.
I 12.35 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.41 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.77 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.46 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.11 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.03 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.17 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.02 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.70 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 74.30 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSOSSMHMRRMIRMSSSSSPHMSSSKNNNNMSSOSHSMSMSISSSMHSSJSMIKNSNHMNSNSFMMSSSHSSSIMRRRSSMHIKNMMFNNRRHMNQRSSMRAIJHLLMMOSKGNNMNSHMMMPSSSSMSHSPSMSOSSSHKMGNNMNMSSHPMSSJSMOMSSHMSIMKNNNSMHMNSSSMSIMO97HMMSSQSSKGMGHNNMRRPARSJMHOSSSMSISSSHKMMGMNMMGNMHOSMPSSSSMHMSSPKMNNMN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.960 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.027 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.093 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.160 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.959 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.758 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.556 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.373 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.189 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.005 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.822 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.724 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.809 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.043 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.820 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.855 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.891 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.671 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.449 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.487 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.558 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.596 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.633 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.669 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.755 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.572 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.658 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.724 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.788 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.856 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.923 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.777 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
0:35.533 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
0:36.288 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:37.044 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:37.798 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:38.556 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:39.313 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.069 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:40.824 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.580 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:42.636 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:43.617 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:44.372 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:45.353 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:46.335 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:47.996 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:49.242 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:50.902 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:52.563 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:54.224 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.636 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.046 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.456 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.866 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.061 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.120 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.531 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.590 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.170 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
1:07.208 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:08.247 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:09.285 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:10.668 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:12.052 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:13.090 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:14.149 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:15.207 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.621 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.680 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.737 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:19.720 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:20.703 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:21.685 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:22.668 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:23.651 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:24.633 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:25.618 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:26.600 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:27.354 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:28.335 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:29.317 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:30.300 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:31.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:33.621 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:35.283 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:36.943 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:38.604 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.663 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.077 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:42.115 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:43.153 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:44.536 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:45.575 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:46.611 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:47.650 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:49.062 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:50.476 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:52.012 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:53.358 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:54.349 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:55.104 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:56.425 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:57.746 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:59.067 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:00.385 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.731 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.731 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.740 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.799 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.417 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:06.426 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:07.435 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:08.781 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:09.794 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:10.805 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:11.560 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:12.497 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:13.251 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:14.004 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:14.760 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:15.681 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:16.436 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:17.399 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:18.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:19.131 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:19.886 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:20.806 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:21.560 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:22.478 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:24.031 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:25.584 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:27.168 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:28.754 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:30.337 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.782 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.194 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.255 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.667 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.052 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.433 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.472 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.856 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.238 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.651 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.191 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.603 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:48.014 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:49.074 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:50.133 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:51.193 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:52.604 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:53.663 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.722 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.133 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.545 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.957 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.967 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.313 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.660 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.006 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.016 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.026 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.036 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.046 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.393 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.452 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.511 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.894 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.933 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:15.252 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:16.244 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:17.564 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.911 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
3:19.922 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
3:20.933 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
3:21.944 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
3:23.290 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:24.674 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:26.273 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:27.264 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
3:28.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.578 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.900 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.221 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.541 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.863 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.855 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.847 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.886 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:39.038 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:39.038 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:40.421 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:41.412 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:44.053 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:45.372 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:46.126 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:47.446 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.767 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:50.253 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
3:51.263 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:52.674 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:53.734 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:55.146 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
3:56.205 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
3:57.215 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:58.561 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:59.908 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:01.255 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.264 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.264 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:03.612 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:04.959 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:06.023 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.435 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:08.848 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.920 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.930 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.940 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:14.288 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.633 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.642 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.989 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:19.310 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:20.692 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:22.225 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:23.608 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:24.953 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:25.963 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:26.974 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:27.985 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:28.994 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:30.004 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:31.353 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:32.364 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
4:33.374 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:34.432 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:35.816 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:36.853 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:38.237 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:39.621 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.680 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.091 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.916 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.325 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.737 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.234 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.582 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.903 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.895 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.216 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
4:56.538 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:57.530 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:58.540 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:59.550 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81824 81824 44295
Intellect 59405 57174 47126 (20870)
Spirit 0 0 0
Health 4909440 4909440 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59405 57174 0
Crit 20.33% 20.33% 6133
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.79% 58.79% 7253
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 957, weapon: { 4465 - 8293, 2.6 }, stats: { +1582 Int, +2373 Sta, +445 Crit, +428 Mastery, +20134 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 957, stats: { +2076 Int, +3115 Sta, +585 Crit, +561 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="3ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,ilevel=957
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=934.00
# gear_stamina=44295
# gear_intellect=47126
# gear_crit_rating=6133
# gear_haste_rating=11779
# gear_mastery_rating=7253
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

baseline : 1053618 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1053618.1 1053618.1 842.6 / 0.080% 163376.8 / 15.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1053618
Earth Shock 108903 10.3% 16.5 17.48sec 1980916 2046193 Direct 16.5 1399357 3879671 1980924 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9681 0.0000 32667466.82 32667466.82 0.00 2046192.72 2046192.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.62 76.55% 1399357.07 1135077 1669384 1399839.38 1232186 1538252 17666374 17666374 0.00
crit 3.87 23.45% 3879671.45 3141892 4620854 3822620.76 0 4620854 15001093 15001093 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63055 (96526) 6.0% (9.2%) 22.1 13.75sec 1309837 988443 Direct 22.0 609269 1686881 857661 23.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.05 0.00 0.00 1.3252 0.0000 18907714.45 18907714.45 0.00 988443.30 988443.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 76.95% 609268.62 521261 680768 609355.35 569002 647685 10335742 10335742 0.00
crit 5.08 23.05% 1686881.18 1442850 1884366 1680743.95 0 1884366 8571973 8571973 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33470 3.2% 14.0 20.95sec 717487 0 Direct 14.0 511894 1416484 719066 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.96 0.00 0.00 0.0000 0.0000 10034893.88 10034893.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.76 77.10% 511893.67 437859 571845 512006.48 465832 556958 5507500 5507500 0.00
crit 3.20 22.90% 1416483.61 1211994 1582868 1369002.81 0 1582868 4527394 4527394 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61451 5.8% 11.2 27.75sec 1641230 1710385 Direct 11.2 91995 255091 129809 23.2%  
Periodic 236.3 50962 141043 71814 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 11.23 236.29 236.29 0.9596 1.2621 18425977.92 18425977.92 0.00 59630.80 1710385.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 76.82% 91995.44 77837 101655 91982.59 83826 98534 793431 793431 0.00
crit 2.60 23.18% 255090.91 215453 281381 240837.89 0 281381 663802 663802 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.6 76.85% 50961.64 55 55911 50963.41 47228 52982 9254201 9254201 0.00
crit 54.7 23.15% 141042.65 412 154763 141045.20 128293 147624 7714545 7714545 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 122938 11.7% 38.4 7.54sec 960174 1004697 Direct 38.4 678732 1879512 960206 23.4%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.38 38.38 0.00 0.00 0.9557 0.0000 36850279.16 36850279.16 0.00 1004697.07 1004697.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.38 76.56% 678732.25 589674 770114 679058.85 633427 726812 19943557 19943557 0.00
crit 9.00 23.44% 1879511.60 1468997 2131677 1878603.80 1632219 2131677 16906723 16906723 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35214 (54095) 3.3% (5.1%) 9.7 32.12sec 1671583 1313860 Direct 9.7 770636 2137675 1091123 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.68 0.00 0.00 1.2723 0.0000 10556384.69 10556384.69 0.00 1313860.35 1313860.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.56% 770636.39 663371 866364 770728.15 678200 866364 5708587 5708587 0.00
crit 2.27 23.44% 2137674.98 1836210 2398095 1973116.74 0 2398095 4847798 4847798 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18881 1.8% 6.2 47.22sec 913666 0 Direct 6.2 647357 1793725 915773 23.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.18 0.00 0.00 0.0000 0.0000 5657965.91 5657965.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.73 76.59% 647357.11 557231 727745 646600.50 0 727745 3063100 3063100 0.00
crit 1.45 23.41% 1793725.36 1542417 2014400 1420217.24 0 2014400 2594866 2594866 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156337 (244770) 14.9% (23.3%) 59.1 5.00sec 1241474 1064123 Direct 59.0 0 794941 794941 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.12 58.98 0.00 0.00 1.1667 0.0000 46882737.01 46882737.01 0.00 1064123.04 1064123.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.98 100.00% 794940.96 692614 904556 795012.85 760883 832168 46882737 46882737 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80317 7.6% 37.6 7.83sec 640226 0 Direct 37.5 0 642099 642099 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.61 37.50 0.00 0.00 0.0000 0.0000 24081278.74 24081278.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.50 100.00% 642099.27 559584 730817 642154.47 603953 686940 24081279 24081279 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8117 0.8% 43.8 6.21sec 55509 0 Direct 43.8 44711 91212 55510 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.85 43.85 0.00 0.00 0.0000 0.0000 2433871.07 2433871.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.66 76.78% 44711.03 42943 47934 44721.72 42943 46642 1505156 1505156 0.00
crit 10.18 23.22% 91211.74 87603 97785 91195.83 0 97785 928715 928715 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122286 (223962) 11.6% (21.3%) 97.1 3.01sec 691554 575315 Direct 97.1 237296 660300 377596 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.08 97.08 0.00 0.00 1.2021 0.0000 36658333.04 36658333.04 0.00 575314.81 575314.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.88 66.83% 237296.41 154272 604437 237579.01 198412 281761 15396293 15396293 0.00
crit 32.20 33.17% 660299.52 427024 1673082 660568.83 481585 904012 21262040 21262040 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101675 9.7% 94.4 3.77sec 322715 0 Direct 94.4 202781 563055 322700 33.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.44 94.44 0.00 0.00 0.0000 0.0000 30478028.33 30478028.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.00 66.71% 202781.18 129588 507727 202901.88 156514 262580 12776538 12776538 0.00
crit 31.44 33.29% 563054.87 358700 1405389 562829.87 396605 836782 17701490 17701490 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59391) 0.0% (5.6%) 3.0 120.39sec 5930450 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.66 0.00 0.0000 1.0000 0.00 0.00 0.00 306783.99 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19002 1.8% 37.6 6.98sec 150566 0 Direct 37.4 121869 248614 151142 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.58 37.44 0.00 0.00 0.0000 0.0000 5658541.30 5658541.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.79 76.91% 121869.49 121869 121869 121869.49 121869 121869 3508939 3508939 0.00
crit 8.65 23.09% 248613.77 248614 248614 248587.09 0 248614 2149602 2149602 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40389 3.8% 98.5 2.62sec 122104 0 Direct 98.3 98655 201256 122412 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.52 98.27 0.00 0.00 0.0000 0.0000 12029089.92 12029089.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.51 76.84% 98654.92 98655 98655 98654.92 98655 98655 7449759 7449759 0.00
crit 22.75 23.16% 201256.04 201256 201256 201256.04 201256 201256 4579331 4579331 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143948 / 55056
Fire Blast 143948 5.2% 62.8 4.30sec 261424 146532 Direct 62.8 212313 424667 261428 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.76 62.76 0.00 0.00 1.7841 0.0000 16407455.71 16407455.71 0.00 146531.77 146531.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.25 76.87% 212312.91 199011 222144 212309.77 207630 219099 10243456 10243456 0.00
crit 14.51 23.13% 424666.60 398022 444288 424660.20 413274 444288 6164000 6164000 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186525 / 26526
Lightning Blast 186525 2.5% 42.0 6.71sec 189067 202320 Direct 42.0 153590 307254 189072 23.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.99 41.99 0.00 0.00 0.9345 0.0000 7939018.28 7939018.28 0.00 202319.53 202319.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.30 76.91% 153590.28 147415 164551 153623.24 148966 161076 4960407 4960407 0.00
crit 9.69 23.09% 307254.38 294831 329102 307263.10 0 329102 2978611 2978611 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0338 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.57sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8210 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.08sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.21 0.00 0.00 0.00 0.5220 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.7sec 34.81% 34.81% 1.4(1.4) 10.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.85% 34.85% 1.4(1.4) 10.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.8sec 23.3sec 34.03% 34.03% 1.8(1.8) 10.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:34.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 72.9 30.3 4.1sec 2.9sec 60.64% 63.23% 30.3(36.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.57%
  • elemental_focus_2:35.07%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.34%
  • icefury_2:5.88%
  • icefury_3:4.94%
  • icefury_4:3.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.30% 39.79% 1.4(1.4) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.30%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.0sec 29.99% 29.99% 4.2(4.2) 12.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.1sec 69.1sec 13.58% 13.58% 0.0(0.0) 3.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.58%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.1sec 0.0sec 39.85% 39.85% 0.0(0.0) 1.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.8sec 30.5sec 21.64% 23.90% 1.4(2.8) 0.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:9.24%

Trigger Attempt Success

  • trigger_pct:14.95%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.46% 8.81% 0.0(0.0) 0.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.25%
  • stormkeeper_2:3.67%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 78.6sec
Lava Surge: During Lava Burst 3.7 58.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6760.0014.2612.4310.0009.064
Fire Elemental0.3370.0011.2490.0920.0001.249
Lava Burst0.8910.0018.1617.2940.00023.991
Elemental Blast0.5300.0014.2538.7932.64119.741
Icefury0.9870.0018.9307.2010.50922.103

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 131.6 15787.4 120.0 957.3 2069.2
flame_shock Maelstrom 89.6 1599.4 17.9 142.5 11520.3
frost_shock Maelstrom 306.2 6124.9 20.0 159.6 6016.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 471.74 5599.59 (23.39%) 11.87 61.30 1.08%
Lava Burst Overload Maelstrom 300.13 2603.23 (10.87%) 8.67 97.95 3.63%
Lightning Bolt Maelstrom 774.67 6180.72 (25.82%) 7.98 16.61 0.27%
Lightning Bolt Overload Maelstrom 753.61 4468.71 (18.67%) 5.93 52.95 1.17%
Icefury Maelstrom 77.40 1846.36 (7.71%) 23.85 11.29 0.61%
Icefury Overload Maelstrom 49.41 880.48 (3.68%) 17.82 8.94 1.01%
Resonance Totem Maelstrom 2381.66 2359.62 (9.86%) 0.99 22.04 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.02 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T20M Fight Length
Count 9320
Mean 300.01
Minimum 239.99
Maximum 360.00
Spread ( max - min ) 120.01
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.4858
5th Percentile 245.10
95th Percentile 354.90
( 95th Percentile - 5th Percentile ) 109.80
Mean Distribution
Standard Deviation 0.3779
95.00% Confidence Intervall ( 299.27 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 569
0.1% Error 56816
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1137
DPS
Sample Data Shaman_Elemental_T20M Damage Per Second
Count 9320
Mean 1053618.05
Minimum 911147.18
Maximum 1218225.50
Spread ( max - min ) 307078.31
Range [ ( max - min ) / 2 * 100% ] 14.57%
Standard Deviation 41505.1652
5th Percentile 987470.10
95th Percentile 1124299.37
( 95th Percentile - 5th Percentile ) 136829.26
Mean Distribution
Standard Deviation 429.9265
95.00% Confidence Intervall ( 1052775.41 - 1054460.69 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5962
0.1 Scale Factor Error with Delta=300 14705777
0.05 Scale Factor Error with Delta=300 58823107
0.01 Scale Factor Error with Delta=300 1470577651
Priority Target DPS
Sample Data Shaman_Elemental_T20M Priority Target Damage Per Second
Count 9320
Mean 1053618.05
Minimum 911147.18
Maximum 1218225.50
Spread ( max - min ) 307078.31
Range [ ( max - min ) / 2 * 100% ] 14.57%
Standard Deviation 41505.1652
5th Percentile 987470.10
95th Percentile 1124299.37
( 95th Percentile - 5th Percentile ) 136829.26
Mean Distribution
Standard Deviation 429.9265
95.00% Confidence Intervall ( 1052775.41 - 1054460.69 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5962
0.1 Scale Factor Error with Delta=300 14705777
0.05 Scale Factor Error with Delta=300 58823107
0.01 Scale Factor Error with Delta=300 1470577651
DPS(e)
Sample Data Shaman_Elemental_T20M Damage Per Second (Effective)
Count 9320
Mean 1053618.05
Minimum 911147.18
Maximum 1218225.50
Spread ( max - min ) 307078.31
Range [ ( max - min ) / 2 * 100% ] 14.57%
Damage
Sample Data Shaman_Elemental_T20M Damage
Count 9320
Mean 291322562.25
Minimum 205352256.37
Maximum 383085795.94
Spread ( max - min ) 177733539.57
Range [ ( max - min ) / 2 * 100% ] 30.50%
DTPS
Sample Data Shaman_Elemental_T20M Damage Taken Per Second
Count 9320
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T20M Healing Per Second
Count 9320
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T20M Healing Per Second (Effective)
Count 9320
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T20M Heal
Count 9320
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T20M Healing Taken Per Second
Count 9320
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T20M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Shaman_Elemental_T20MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shaman_Elemental_T20M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 2.03 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.02 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.26 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.44 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.49 elemental_blast
Keep your EB always on Cooldown.
I 12.50 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.46 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.87 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.65 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.08 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.45 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.12 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.21 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.06 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.91 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.19 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMMNNMNNOSSSMSHSSMISSMSSSSHSMIMMSKNNMNNMHOSSSMMIMSSHSMSJSPSSMKHNNNMNOSMRRHMRISSMSSSHMPKNNSSMFMHNNQMRRRMIAMJHMSSOMKNMLGNHMNRRISMSSSHMMIMSOSMKNHNNMMNSSSSSSMHIMSSJSMLLIMRHKMFNNNMNRMHRR97MSSISMMHOQSSKMGMGNNHMSSPASSSJMSHOSMSSIMKNMHNNNSSMMSSSHIMSOSSSMSSSSHIKMMNNNNR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.964 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.051 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
0:05.895 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:06.649 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.408 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.163 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.918 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.670 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.427 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.182 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.935 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:12.689 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:13.445 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:14.202 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:14.959 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:15.716 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:16.471 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.228 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:18.188 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:19.147 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:20.425 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:21.705 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:22.982 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:24.261 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:25.541 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.714 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.801 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.887 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.974 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.790 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.608 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.692 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.779 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.866 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:36.681 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:37.496 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:38.313 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:39.130 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:39.947 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.033 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.444 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.504 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.850 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.172 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.492 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:48.484 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.476 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.469 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.789 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.135 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.547 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.959 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.370 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.782 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.194 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.314 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.375 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.434 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.493 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.905 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.316 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:09.727 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:10.787 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:11.846 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:12.906 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:14.318 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:15.356 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.394 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.775 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.814 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.199 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.583 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.133 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.480 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.828 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.839 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.186 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.534 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.881 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.228 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.574 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.985 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.542 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.954 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.014 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.426 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:41.484 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:42.545 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:43.956 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:45.366 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:46.777 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:47.838 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:48.896 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:50.281 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:51.318 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:52.357 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.111 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:54.494 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.904 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.314 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.727 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.786 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.844 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.844 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.904 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.963 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.375 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.787 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.845 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.905 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.964 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.374 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.831 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:12.893 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:13.953 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:15.010 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:16.071 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:17.129 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:18.541 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:19.954 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:20.966 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.312 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.659 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.669 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.014 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.361 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.706 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.027 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.409 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.791 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.829 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.148 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.138 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.130 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.452 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:39.445 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.792 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.140 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.486 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:44.548 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:46.170 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:47.162 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:48.153 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:49.143 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:50.464 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:51.454 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.801 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:53.736 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:54.673 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:55.610 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:56.547 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:57.483 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:58.466 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:59.449 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:00.204 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:00.958 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.941 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:02.925 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:03.713 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:04.468 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:05.223 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:06.468 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:07.715 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:08.960 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:10.619 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:12.282 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:13.942 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.353 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:16.764 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:17.803 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:18.843 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:19.883 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:20.923 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:22.307 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:23.345 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.756 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.795 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.322 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.705 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.088 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.126 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.126 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.538 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:33.950 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:35.361 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:36.421 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:37.805 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:38.845 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:40.228 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:41.612 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.652 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.408 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:44.819 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:46.230 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:47.643 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
3:48.702 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
3:49.761 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
3:51.173 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
3:52.234 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
3:53.294 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:54.353 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.765 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:57.148 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:58.470 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:59.791 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.783 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.783 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:02.105 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.424 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.744 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.735 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:07.054 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.113 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.525 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:11.645 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.056 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:14.115 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:15.526 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.585 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.644 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.056 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:20.118 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:21.530 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:22.941 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:24.000 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:25.061 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
4:26.119 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:27.532 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:28.943 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:30.354 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:31.413 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.826 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.238 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.650 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.061 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.099 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.420 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.740 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.731 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:42.648 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:43.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:44.520 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:45.456 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.394 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:47.331 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:48.267 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:49.249 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:50.230 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:50.983 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:51.967 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
4:52.722 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
4:53.682 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, mark_of_the_claw
4:54.903 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw
4:56.124 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw
4:57.344 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
4:58.592 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81584 81584 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4895040 4895040 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ctt_nature : 1057260 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1057259.7 1057259.7 845.4 / 0.080% 164243.3 / 15.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ctt_nature 1057260
Earth Shock 109712 10.4% 16.5 17.47sec 1995023 2060778 Direct 16.5 1412863 3911372 1995096 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.50 16.50 0.00 0.00 0.9681 0.0000 32908566.50 32908566.50 0.00 2060778.16 2060778.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.65 76.70% 1412862.68 1145991 1685435 1413256.72 1279503 1597977 17875131 17875131 0.00
crit 3.84 23.30% 3911371.55 3172102 4665285 3845139.30 0 4665285 15033435 15033435 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63631 (97349) 6.0% (9.2%) 22.1 13.75sec 1320902 996386 Direct 22.0 614941 1702863 865276 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.05 0.00 0.00 1.3257 0.0000 19076719.23 19076719.23 0.00 996385.77 996385.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.97 76.99% 614940.90 526273 687314 615044.20 575682 652444 10438094 10438094 0.00
crit 5.07 23.01% 1702862.79 1456724 1902485 1696468.73 0 1902485 8638625 8638625 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33718 3.2% 14.0 20.97sec 723692 0 Direct 13.9 516762 1429532 725438 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.97 13.94 0.00 0.00 0.0000 0.0000 10112401.96 10112401.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.75 77.14% 516761.85 442069 577344 516866.61 469251 562544 5556803 5556803 0.00
crit 3.19 22.86% 1429532.06 1223648 1598088 1379178.89 0 1598088 4555599 4555599 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61465 5.8% 11.2 27.75sec 1642619 1712544 Direct 11.2 91999 255330 129756 23.1%  
Periodic 236.2 50963 141046 71845 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.22 236.22 0.9593 1.2624 18426971.70 18426971.70 0.00 59638.65 1712543.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 76.88% 91999.01 77837 101655 91985.64 81875 101655 793433 793433 0.00
crit 2.59 23.12% 255329.82 215453 281381 240489.26 0 281381 662232 662232 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.5 76.82% 50963.27 41 55911 50965.69 46659 52845 9248110 9248110 0.00
crit 54.8 23.18% 141046.01 253 154763 141048.71 128934 147316 7723197 7723197 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123074 11.6% 38.4 7.54sec 961779 1006191 Direct 38.4 678791 1880939 961786 23.5%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.35 38.35 0.00 0.00 0.9559 0.0000 36884932.15 36884932.15 0.00 1006190.52 1006190.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.32 76.46% 678790.95 534687 770114 679170.17 639617 724303 19904279 19904279 0.00
crit 9.03 23.54% 1880939.41 1575499 2131677 1879107.32 0 2131677 16980653 16980653 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35069 (53947) 3.3% (5.1%) 9.7 32.14sec 1668348 1309992 Direct 9.7 771071 2135158 1087210 23.2%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2736 0.0000 10511887.34 10511887.34 0.00 1309992.26 1309992.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.43 76.82% 771070.81 663371 866364 771151.96 673257 854797 5727053 5727053 0.00
crit 2.24 23.18% 2135157.62 1836210 2398095 1962802.72 0 2398095 4784834 4784834 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18878 1.8% 6.2 46.38sec 912264 0 Direct 6.2 647846 1790664 914504 23.3%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.18 0.00 0.00 0.0000 0.0000 5656037.14 5656037.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.74 76.66% 647845.58 557231 727745 646788.46 0 727745 3071653 3071653 0.00
crit 1.44 23.34% 1790663.81 1542417 2014400 1406645.50 0 2014400 2584385 2584385 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156407 (245003) 14.8% (23.2%) 59.2 5.02sec 1242126 1064479 Direct 59.0 0 794865 794865 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.16 59.01 0.00 0.00 1.1669 0.0000 46908991.31 46908991.31 0.00 1064479.11 1064479.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.01 100.00% 794865.16 692614 904556 794958.25 763163 827413 46908991 46908991 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80492 7.6% 37.7 7.80sec 640218 0 Direct 37.6 0 642189 642189 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.71 37.59 0.00 0.00 0.0000 0.0000 24141236.59 24141236.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.59 100.00% 642188.59 559584 730817 642270.18 606874 675206 24141237 24141237 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8104 0.8% 43.8 6.16sec 55487 0 Direct 43.8 44708 91217 55488 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.81 43.81 0.00 0.00 0.0000 0.0000 2430765.27 2430765.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.65 76.82% 44708.46 42943 47934 44718.32 43066 46974 1504641 1504641 0.00
crit 10.15 23.18% 91217.39 87603 97785 91221.79 0 97785 926124 926124 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 123378 (225807) 11.7% (21.4%) 97.0 3.01sec 697732 580200 Direct 97.0 239643 666106 381175 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.00 97.00 0.00 0.00 1.2026 0.0000 36976201.51 36976201.51 0.00 580199.88 580199.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.81 66.81% 239643.14 155755 610249 239943.69 202484 285064 15530722 15530722 0.00
crit 32.19 33.19% 666105.80 431130 1689170 666304.11 480517 911256 21445479 21445479 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 102429 9.7% 94.4 3.77sec 325406 0 Direct 94.4 204607 568961 325405 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.36 94.36 0.00 0.00 0.0000 0.0000 30704694.90 30704694.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.08 66.85% 204607.35 130834 512609 204703.60 161261 268712 12905922 12905922 0.00
crit 31.28 33.15% 568961.15 362149 1418903 569118.77 409367 841658 17798773 17798773 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59374) 0.0% (5.6%) 3.0 120.39sec 5927948 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.63 0.00 0.0000 1.0000 0.00 0.00 0.00 306818.16 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19010 1.8% 37.6 7.00sec 150693 0 Direct 37.4 121869 248614 151303 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.42 0.00 0.00 0.0000 0.0000 5661070.86 5661070.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.73 76.78% 121869.49 121869 121869 121869.49 121869 121869 3500876 3500876 0.00
crit 8.69 23.22% 248613.77 248614 248614 248560.98 0 248614 2160195 2160195 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40364 3.8% 98.5 2.62sec 122038 0 Direct 98.3 98655 201256 122345 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.51 98.26 0.00 0.00 0.0000 0.0000 12022087.13 12022087.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.58 76.91% 98654.92 98655 98655 98654.92 98655 98655 7455882 7455882 0.00
crit 22.69 23.09% 201256.04 201256 201256 201256.04 201256 201256 4566205 4566205 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143889 / 55033
Fire Blast 143889 5.2% 62.7 4.30sec 261538 146471 Direct 62.7 212291 424640 261538 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.72 62.72 0.00 0.00 1.7856 0.0000 16403186.97 16403186.97 0.00 146471.41 146471.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.17 76.81% 212291.45 199011 222144 212291.36 207538 220048 10226674 10226674 0.00
crit 14.55 23.19% 424640.48 398022 444288 424635.67 413592 444288 6176513 6176513 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186637 / 26495
Lightning Blast 186637 2.5% 41.9 6.69sec 189157 202411 Direct 41.9 153560 307129 189155 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.92 41.92 0.00 0.00 0.9345 0.0000 7929634.33 7929634.33 0.00 202410.51 202410.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.20 76.82% 153560.37 147415 164551 153592.20 149197 160755 4945227 4945227 0.00
crit 9.72 23.18% 307129.37 294831 329102 307178.20 294831 329102 2984408 2984408 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ctt_nature
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0336 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.56sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.8210 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.05sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5216 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.17% 32.17% 3.1(3.1) 8.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.5 27.3sec 23.7sec 34.75% 34.75% 1.5(1.5) 10.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.81% 34.81% 1.4(1.4) 10.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.93% 33.93% 1.8(1.8) 9.9

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.2 4.1sec 2.9sec 60.70% 63.27% 30.2(36.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:35.06%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.36%
  • icefury_2:5.86%
  • icefury_3:4.96%
  • icefury_4:3.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.3 13.0sec 12.2sec 10.35% 39.83% 1.3(1.3) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.35%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.92% 29.92% 4.2(4.2) 12.7

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.92%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.1sec 0.0sec 39.85% 39.85% 0.0(0.0) 1.7

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.8sec 30.4sec 21.65% 23.96% 1.4(2.9) 0.1

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.27%
  • power_of_the_maelstrom_3:9.24%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.47% 8.81% 0.0(0.0) 0.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.68%
  • stormkeeper_3:4.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 78.3sec
Lava Surge: During Lava Burst 3.7 57.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6770.0014.2192.4290.0008.901
Fire Elemental0.3380.0011.2500.0910.0001.250
Lava Burst0.9010.00110.1357.3390.00027.914
Elemental Blast0.5320.0013.8998.8232.73118.111
Icefury0.9880.0018.4617.2100.73524.394

Resources

Resource Usage Type Count Total Average RPE APR
ctt_nature
earth_shock Maelstrom 135.0 16194.1 120.0 981.7 2032.1
flame_shock Maelstrom 91.8 1640.8 17.9 146.3 11230.6
frost_shock Maelstrom 313.9 6277.4 20.0 163.7 5875.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 484.12 5747.59 (23.41%) 11.87 61.86 1.06%
Lava Burst Overload Maelstrom 308.59 2676.80 (10.90%) 8.67 100.54 3.62%
Lightning Bolt Maelstrom 793.87 6334.38 (25.80%) 7.98 16.57 0.26%
Lightning Bolt Overload Maelstrom 772.22 4579.27 (18.65%) 5.93 54.02 1.17%
Icefury Maelstrom 79.31 1891.45 (7.70%) 23.85 12.05 0.63%
Icefury Overload Maelstrom 50.74 903.33 (3.68%) 17.80 9.99 1.09%
Resonance Totem Maelstrom 2442.61 2419.86 (9.86%) 0.99 22.75 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 52.31 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ctt_nature Fight Length
Count 9420
Mean 300.00
Minimum 239.99
Maximum 360.02
Spread ( max - min ) 120.03
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.2629
5th Percentile 244.86
95th Percentile 355.14
( 95th Percentile - 5th Percentile ) 110.28
Mean Distribution
Standard Deviation 0.3736
95.00% Confidence Intervall ( 299.27 - 300.73 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 562
0.1% Error 56129
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1123
DPS
Sample Data ctt_nature Damage Per Second
Count 9420
Mean 1057259.71
Minimum 904557.21
Maximum 1253659.86
Spread ( max - min ) 349102.65
Range [ ( max - min ) / 2 * 100% ] 16.51%
Standard Deviation 41861.5314
5th Percentile 990722.34
95th Percentile 1127520.97
( 95th Percentile - 5th Percentile ) 136798.63
Mean Distribution
Standard Deviation 431.3101
95.00% Confidence Intervall ( 1056414.36 - 1058105.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6023
0.1 Scale Factor Error with Delta=300 14959391
0.05 Scale Factor Error with Delta=300 59837561
0.01 Scale Factor Error with Delta=300 1495939024
Priority Target DPS
Sample Data ctt_nature Priority Target Damage Per Second
Count 9420
Mean 1057259.71
Minimum 904557.21
Maximum 1253659.86
Spread ( max - min ) 349102.65
Range [ ( max - min ) / 2 * 100% ] 16.51%
Standard Deviation 41861.5314
5th Percentile 990722.34
95th Percentile 1127520.97
( 95th Percentile - 5th Percentile ) 136798.63
Mean Distribution
Standard Deviation 431.3101
95.00% Confidence Intervall ( 1056414.36 - 1058105.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6023
0.1 Scale Factor Error with Delta=300 14959391
0.05 Scale Factor Error with Delta=300 59837561
0.01 Scale Factor Error with Delta=300 1495939024
DPS(e)
Sample Data ctt_nature Damage Per Second (Effective)
Count 9420
Mean 1057259.71
Minimum 904557.21
Maximum 1253659.86
Spread ( max - min ) 349102.65
Range [ ( max - min ) / 2 * 100% ] 16.51%
Damage
Sample Data ctt_nature Damage
Count 9420
Mean 292422563.58
Minimum 211719342.07
Maximum 382628901.68
Spread ( max - min ) 170909559.61
Range [ ( max - min ) / 2 * 100% ] 29.22%
DTPS
Sample Data ctt_nature Damage Taken Per Second
Count 9420
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ctt_nature Healing Per Second
Count 9420
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ctt_nature Healing Per Second (Effective)
Count 9420
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ctt_nature Heal
Count 9420
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ctt_nature Healing Taken Per Second
Count 9420
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ctt_nature Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ctt_natureTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ctt_nature Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.05 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.06 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.31 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.56 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.74 elemental_blast
Keep your EB always on Cooldown.
I 12.58 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.51 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.97 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.64 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.75 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.73 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.18 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.32 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.07 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.22 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.85 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNMNSOSSMSSHMSMIMSSSSSMIMMHSSMSSIKMMNNMNHNMMORRMIMMHRSSJMMIKNMHMNNNSMFSSSSHMMSSISMSSHKMMGGNNSFMHQSSSMISSSAJHMSSOKNMGNNSHSMSSISSMSSHSSSMISSOSSKNHMMNMNNSMSMHISSJMSSSSMHIKMFMMNNNRMH97MNRRSMISOHSMQSKNNNMNHRRRMPRRARJSHMLILRMSFKNHNMMNNRMRMIHMMRORSMMSSHIKMNMNMNNSM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.879 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:02.633 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.387 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.139 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.892 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.647 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.401 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.156 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.911 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.665 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.419 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.173 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.929 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.682 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:12.438 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.194 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:14.472 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:15.892 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:16.852 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:18.130 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:19.089 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:20.049 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:21.327 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.082 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.839 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:23.595 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:24.351 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:25.109 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:25.863 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:26.618 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:27.373 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:28.130 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:28.886 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:29.643 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:30.400 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:31.154 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:31.910 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:32.667 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:33.422 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:34.700 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:35.639 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:36.891 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:37.832 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:38.770 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:39.712 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw, potion_of_prolonged_power
0:40.654 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:42.160 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:43.198 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.581 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.618 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.656 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.039 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.450 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.509 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.569 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.041 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.567 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.978 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.388 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.799 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.061 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.471 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.529 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.588 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.107 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.166 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:08.578 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:09.990 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
1:10.983 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
1:11.974 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
1:12.965 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
1:13.955 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:14.945 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:16.267 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.280 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.627 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.974 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.321 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.733 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.117 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.500 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.540 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.924 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.307 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.367 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.777 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.159 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.542 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:35.925 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.498 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:38.845 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:40.190 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:41.535 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:42.547 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:43.557 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:44.568 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:45.579 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:46.923 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:47.934 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.346 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.903 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.658 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.005 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.350 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:55.697 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:57.043 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:58.053 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:59.401 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:00.748 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.094 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.094 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:03.155 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:05.952 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:06.990 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:08.029 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:09.069 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:10.450 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
2:11.489 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:12.901 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:13.961 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:15.019 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:16.079 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.139 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.551 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.961 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.307 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.653 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.999 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.009 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.356 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.703 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.051 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:30.035 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:31.017 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:31.999 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:32.934 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:33.871 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:34.807 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:35.743 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:36.496 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:37.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:38.369 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:39.123 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:40.060 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:40.979 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:42.533 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), devils_due, mark_of_the_claw
2:43.757 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw
2:45.623 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due, mark_of_the_claw
2:46.789 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due
2:48.372 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
2:49.363 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:50.356 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:51.346 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:52.337 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.657 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.977 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.323 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.384 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.029 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.087 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.499 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.910 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.210 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.722 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.761 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.144 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.527 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.909 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.919 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.265 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:16.278 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:17.289 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.300 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:19.646 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
3:20.638 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:21.630 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:22.620 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:23.941 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:24.979 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:26.362 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:27.422 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:27.422 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:28.832 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:29.892 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:31.304 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:32.715 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:34.128 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:35.539 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:36.599 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:38.011 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:39.069 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:40.481 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:41.865 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:43.250 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:44.004 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:45.387 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:46.771 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
3:47.830 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
3:48.889 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
3:49.947 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
3:51.357 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
3:52.415 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:53.888 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:55.236 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:56.556 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:57.875 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
3:59.195 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:00.187 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:01.508 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:02.829 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:02.829 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:04.174 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:05.264 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:06.323 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.734 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.080 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.089 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.099 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.109 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:13.455 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:14.799 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:16.145 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.156 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.502 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:19.561 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
4:21.142 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
4:22.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
4:23.262 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
4:24.674 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
4:25.733 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
4:26.792 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:28.204 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.263 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.674 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.085 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.145 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.556 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.890 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.210 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.203 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.847 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.839 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.186 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.531 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.943 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:48.326 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.364 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.684 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:52.003 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:52.994 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:54.004 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:55.013 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:56.023 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:57.033 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
4:58.043 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.389 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ctt_nature"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:5:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ea_es : 1057496 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1057495.9 1057495.9 845.5 / 0.080% 163260.2 / 15.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ea_es 1057496
Earth Shock 112617 10.7% 16.5 17.52sec 2048492 2116538 Direct 16.5 1446590 4010758 2048404 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9679 0.0000 33771483.48 33771483.48 0.00 2116538.20 2116538.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.62 76.53% 1446590.36 1174217 1726949 1447089.85 1307721 1603260 18250320 18250320 0.00
crit 3.87 23.47% 4010757.68 3250233 4780194 3955915.59 0 4780194 15521163 15521163 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63026 (96373) 6.0% (9.1%) 22.1 13.76sec 1308013 987255 Direct 22.0 609262 1686252 857365 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.04 0.00 0.00 1.3249 0.0000 18898932.53 18898932.53 0.00 987255.47 987255.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.97 76.96% 609262.39 521261 680768 609387.59 558798 652802 10336420 10336420 0.00
crit 5.08 23.04% 1686251.86 1442850 1884366 1679187.65 0 1884366 8562513 8562513 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33347 3.2% 13.9 21.20sec 717324 0 Direct 13.9 511692 1416450 719048 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 10002971.43 10002971.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.72 77.08% 511692.29 437859 571845 511822.22 456135 551995 5486409 5486409 0.00
crit 3.19 22.92% 1416449.68 1211994 1582868 1368987.12 0 1582868 4516563 4516563 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61492 5.8% 11.2 27.78sec 1642639 1713008 Direct 11.2 92011 255100 129821 23.2%  
Periodic 236.3 50966 141077 71850 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.32 236.32 0.9589 1.2619 18437101.02 18437101.02 0.00 59668.92 1713007.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 76.81% 92011.22 77837 101655 91995.14 79577 99619 793291 793291 0.00
crit 2.60 23.19% 255100.31 215453 281381 242016.15 0 281381 663873 663873 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.5 76.82% 50965.80 37 55911 50969.08 47144 52787 9252851 9252851 0.00
crit 54.8 23.18% 141077.00 111 154763 141080.63 131745 148290 7727086 7727086 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123173 11.7% 38.4 7.54sec 962425 1006559 Direct 38.4 678894 1880354 962370 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.36 38.36 0.00 0.00 0.9562 0.0000 36921607.28 36921607.28 0.00 1006559.45 1006559.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 76.40% 678894.02 530707 770114 679261.94 636833 730112 19898175 19898175 0.00
crit 9.05 23.60% 1880353.90 1632219 2131677 1879176.57 1632219 2131677 17023432 17023432 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35131 (53895) 3.3% (5.1%) 9.7 32.13sec 1666308 1309056 Direct 9.7 771280 2134482 1088725 23.3%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2730 0.0000 10529761.16 10529761.16 0.00 1309056.19 1309056.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 76.71% 771279.58 663371 866364 771401.76 678200 866364 5722151 5722151 0.00
crit 2.25 23.29% 2134481.81 1836210 2398095 1961773.33 0 2398095 4807610 4807610 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18765 1.8% 6.2 46.97sec 909709 0 Direct 6.2 647794 1794026 911541 23.0%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.17 0.00 0.00 0.0000 0.0000 5622683.15 5622683.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.75 76.99% 647793.65 557231 727745 647017.33 0 727745 3076052 3076052 0.00
crit 1.42 23.01% 1794026.41 1542417 2014400 1403625.64 0 2014400 2546631 2546631 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156166 (244511) 14.8% (23.1%) 59.0 5.03sec 1241661 1063837 Direct 58.9 0 794921 794921 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.04 58.90 0.00 0.00 1.1672 0.0000 46823788.55 46823788.55 0.00 1063836.98 1063836.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.90 100.00% 794921.31 692614 904556 795015.11 762313 826627 46823789 46823789 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80229 7.6% 37.6 7.88sec 640151 0 Direct 37.5 0 642170 642170 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.46 0.00 0.00 0.0000 0.0000 24053141.03 24053141.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.46 100.00% 642170.08 559584 730817 642239.30 601464 678674 24053141 24053141 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8115 0.8% 43.8 6.21sec 55497 0 Direct 43.8 44716 91205 55496 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.84 43.84 0.00 0.00 0.0000 0.0000 2433140.69 2433140.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.68 76.81% 44716.25 42943 47934 44724.59 43156 47001 1505848 1505848 0.00
crit 10.17 23.19% 91204.70 87603 97785 91204.78 0 97785 927293 927293 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122636 (224400) 11.6% (21.2%) 97.1 3.01sec 692338 575944 Direct 97.1 237153 661214 378389 33.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.15 97.15 0.00 0.00 1.2021 0.0000 36759865.89 36759865.89 0.00 575944.16 575944.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.79 66.69% 237153.14 154272 604437 237433.97 196353 281676 15365535 15365535 0.00
crit 32.35 33.31% 661214.44 427024 1673082 661568.36 486675 900462 21394331 21394331 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101764 9.6% 94.5 3.77sec 322805 0 Direct 94.5 202737 564268 322797 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.48 94.48 0.00 0.00 0.0000 0.0000 30498316.74 30498316.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.10 66.79% 202736.74 129588 507727 202839.69 159453 255680 12793581 12793581 0.00
crit 31.38 33.21% 564267.51 358700 1405389 564537.18 401137 843772 17704736 17704736 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59401) 0.0% (5.6%) 3.0 120.37sec 5927261 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.67 0.00 0.0000 1.0000 0.00 0.00 0.00 306719.73 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19004 1.8% 37.6 7.00sec 150640 0 Direct 37.4 121869 248614 151259 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.41 0.00 0.00 0.0000 0.0000 5658501.51 5658501.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.74 76.81% 121869.49 121869 121869 121869.49 121869 121869 3502018 3502018 0.00
crit 8.67 23.19% 248613.77 248614 248614 248507.66 0 248614 2156483 2156483 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40396 3.8% 98.6 2.62sec 122027 0 Direct 98.3 98655 201256 122345 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.59 98.34 0.00 0.00 0.0000 0.0000 12030945.43 12030945.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.63 76.91% 98654.92 98655 98655 98654.92 98655 98655 7461626 7461626 0.00
crit 22.70 23.09% 201256.04 201256 201256 201256.04 201256 201256 4569320 4569320 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143917 / 55067
Fire Blast 143917 5.2% 62.8 4.31sec 261546 146521 Direct 62.8 212307 424544 261543 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.76 62.76 0.00 0.00 1.7850 0.0000 16413388.64 16413388.64 0.00 146520.64 146520.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.20 76.80% 212306.75 199011 222144 212304.64 207654 219497 10232309 10232309 0.00
crit 14.56 23.20% 424544.09 398022 444288 424529.83 413274 444288 6181079 6181079 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186868 / 26569
Lightning Blast 186868 2.5% 42.0 6.71sec 189228 202678 Direct 42.0 153567 307252 189228 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.03 42.03 0.00 0.00 0.9337 0.0000 7953887.37 7953887.37 0.00 202677.79 202677.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.28 76.80% 153567.00 147415 164551 153607.03 149063 161538 4957087 4957087 0.00
crit 9.75 23.20% 307251.76 294831 329102 307313.31 294831 329102 2996801 2996801 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ea_es
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0342 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8208 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.14sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.25% 32.25% 3.1(3.1) 8.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.9sec 68.9sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.1sec 23.6sec 34.97% 34.97% 1.4(1.4) 10.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.84% 34.84% 1.4(1.4) 10.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.4sec 33.81% 33.81% 1.8(1.8) 9.9

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.81%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.3 4.1sec 2.9sec 60.73% 63.31% 30.3(36.3) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.61%
  • elemental_focus_2:35.12%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.28% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.37%
  • icefury_2:5.84%
  • icefury_3:4.94%
  • icefury_4:3.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.3 13.0sec 12.2sec 10.28% 39.65% 1.3(1.3) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.28%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.0sec 30.05% 30.05% 4.2(4.2) 12.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.2sec 0.0sec 39.84% 39.84% 0.0(0.0) 1.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.7sec 30.3sec 21.70% 23.93% 1.4(2.9) 0.1

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.20%
  • power_of_the_maelstrom_2:6.27%
  • power_of_the_maelstrom_3:9.22%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.2sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.52% 8.81% 0.0(0.0) 0.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.29%
  • stormkeeper_2:3.70%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.2sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 79.5sec
Lava Surge: During Lava Burst 3.7 57.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6800.0014.3042.4620.0008.945
Fire Elemental0.3330.0011.2490.0870.0001.249
Lava Burst0.8950.0019.2427.2670.00023.956
Elemental Blast0.5320.0014.1808.8402.31320.049
Icefury0.9830.0018.3087.1700.33422.188

Resources

Resource Usage Type Count Total Average RPE APR
ea_es
earth_shock Maelstrom 131.5 15772.2 119.9 956.7 2141.2
flame_shock Maelstrom 89.5 1600.0 17.9 142.5 11523.3
frost_shock Maelstrom 306.0 6120.0 20.0 159.5 6033.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 470.92 5590.55 (23.37%) 11.87 60.53 1.07%
Lava Burst Overload Maelstrom 299.69 2601.02 (10.87%) 8.68 96.15 3.56%
Lightning Bolt Maelstrom 774.87 6182.55 (25.84%) 7.98 16.38 0.26%
Lightning Bolt Overload Maelstrom 753.62 4469.36 (18.68%) 5.93 52.33 1.16%
Icefury Maelstrom 77.32 1844.14 (7.71%) 23.85 11.53 0.62%
Icefury Overload Maelstrom 49.30 878.58 (3.67%) 17.82 8.87 1.00%
Resonance Totem Maelstrom 2380.61 2358.84 (9.86%) 0.99 21.78 0.91%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.73 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ea_es Fight Length
Count 9372
Mean 300.01
Minimum 239.99
Maximum 360.02
Spread ( max - min ) 120.03
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.3560
5th Percentile 245.33
95th Percentile 354.69
( 95th Percentile - 5th Percentile ) 109.36
Mean Distribution
Standard Deviation 0.3755
95.00% Confidence Intervall ( 299.27 - 300.75 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 565
0.1% Error 56413
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1129
DPS
Sample Data ea_es Damage Per Second
Count 9372
Mean 1057495.92
Minimum 923445.76
Maximum 1245765.18
Spread ( max - min ) 322319.41
Range [ ( max - min ) / 2 * 100% ] 15.24%
Standard Deviation 41762.3908
5th Percentile 992129.20
95th Percentile 1128208.21
( 95th Percentile - 5th Percentile ) 136079.01
Mean Distribution
Standard Deviation 431.3891
95.00% Confidence Intervall ( 1056650.41 - 1058341.43 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5992
0.1 Scale Factor Error with Delta=300 14888618
0.05 Scale Factor Error with Delta=300 59554471
0.01 Scale Factor Error with Delta=300 1488861761
Priority Target DPS
Sample Data ea_es Priority Target Damage Per Second
Count 9372
Mean 1057495.92
Minimum 923445.76
Maximum 1245765.18
Spread ( max - min ) 322319.41
Range [ ( max - min ) / 2 * 100% ] 15.24%
Standard Deviation 41762.3908
5th Percentile 992129.20
95th Percentile 1128208.21
( 95th Percentile - 5th Percentile ) 136079.01
Mean Distribution
Standard Deviation 431.3891
95.00% Confidence Intervall ( 1056650.41 - 1058341.43 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5992
0.1 Scale Factor Error with Delta=300 14888618
0.05 Scale Factor Error with Delta=300 59554471
0.01 Scale Factor Error with Delta=300 1488861761
DPS(e)
Sample Data ea_es Damage Per Second (Effective)
Count 9372
Mean 1057495.92
Minimum 923445.76
Maximum 1245765.18
Spread ( max - min ) 322319.41
Range [ ( max - min ) / 2 * 100% ] 15.24%
Damage
Sample Data ea_es Damage
Count 9372
Mean 292442239.90
Minimum 212882283.66
Maximum 391597827.51
Spread ( max - min ) 178715543.85
Range [ ( max - min ) / 2 * 100% ] 30.56%
DTPS
Sample Data ea_es Damage Taken Per Second
Count 9372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ea_es Healing Per Second
Count 9372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ea_es Healing Per Second (Effective)
Count 9372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ea_es Heal
Count 9372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ea_es Healing Taken Per Second
Count 9372
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ea_es Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ea_esTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ea_es Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.20 totem_mastery,if=buff.resonance_totem.remains<2
9 2.04 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.04 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.29 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.43 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.62 elemental_blast
Keep your EB always on Cooldown.
I 12.49 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.49 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.92 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.67 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.34 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.67 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.15 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.31 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.05 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.05 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.66 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSOSSSMMHSSPMSMSSMSSSISSHSMSSKGGNMMGMHMIRFMMRRRMHIMRJLLMMPKHNNSMFNSNMMSHSSSMISSMSSHKMGNNNFMRMHQMRIRSSAMJSHSSIMMKNMNFNMHNRRRMMSISSHMRORRSMIKHNNMMNNSSSMHMMJSPMMOSSSHMKNNNNSMSSHP97SMSSSSMSOSMIHQSSMKNNNNSHMSSASMMIJMSHOSSMSSSSSIHKMNNMNMNRRHMMORSISMSSHSMMMIKN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.944 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.012 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.142 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.941 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:07.740 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:08.558 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:09.374 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.191 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.008 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.640 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.727 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:14.481 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.237 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:15.995 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:16.751 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:17.506 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:18.260 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:19.015 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:19.769 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:20.524 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:21.278 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.034 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:22.789 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:23.544 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:24.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:25.053 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:25.950 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:27.147 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:28.401 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:29.655 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:30.906 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:32.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:33.462 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.550 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.637 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:36.455 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:37.269 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:38.084 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:39.170 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:39.988 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:40.805 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.621 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.061 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.473 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.533 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.942 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.001 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.060 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.471 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.882 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.295 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.706 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.764 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.177 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.237 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.648 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.060 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.121 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.180 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.218 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.257 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.641 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.679 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:09.062 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:10.582 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:11.642 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:12.702 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:13.760 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:15.171 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:16.230 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:17.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:18.702 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:19.761 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.820 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.230 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.613 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.996 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.379 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.701 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.021 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.341 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.332 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.652 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.964 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:36.285 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.669 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.079 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:40.462 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:41.844 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:42.882 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:43.921 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:44.959 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:45.998 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.057 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.469 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.881 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.939 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.489 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.244 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:54.590 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:55.936 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:56.946 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:58.292 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:59.641 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:00.986 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:00.986 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:02.333 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:03.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:04.362 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:05.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:06.905 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:07.896 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:08.888 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.901 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.249 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.593 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
2:13.583 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
2:14.574 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
2:15.565 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:16.557 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:17.597 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:18.980 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:20.393 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:21.454 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.867 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.279 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.690 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:26.727 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:28.111 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:29.493 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:30.533 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:31.916 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.329 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.741 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.153 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.564 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.624 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.034 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.416 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.800 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:44.184 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.222 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.605 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
2:48.120 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:49.178 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:50.239 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:51.298 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:52.710 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:53.768 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:54.807 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.190 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.574 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.998 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.527 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.938 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.998 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.119 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.176 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.589 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.628 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.666 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.704 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.741 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.123 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.535 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.946 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.358 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:19.416 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:20.476 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:21.534 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:22.592 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.004 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.415 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.826 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.238 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:29.219 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:29.975 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:30.753 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:30.753 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:31.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:32.625 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:33.562 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:34.498 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:35.433 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:36.371 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:37.124 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:38.043 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:38.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:39.715 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:40.678 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:41.897 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:43.524 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:44.338 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:45.966 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:47.593 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:49.220 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:50.631 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
3:51.692 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:52.751 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:53.812 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:54.872 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:56.283 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.694 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.040 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.386 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.733 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.078 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.089 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:05.434 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:06.444 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.453 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.798 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.858 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.271 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:12.330 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:13.340 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:14.352 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:15.698 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:17.045 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:18.392 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:19.738 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:21.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:22.380 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:23.416 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:24.800 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:26.185 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
4:27.570 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
4:28.610 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
4:29.648 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
4:31.032 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:32.091 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:33.150 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:34.209 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.622 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.033 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.444 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.503 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.915 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.974 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.386 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.794 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.854 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.265 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.677 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.471 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.856 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.240 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.233 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.554 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.565 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.575 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.921 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ea_es"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:5:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

ede_crit : 1064137 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1064137.5 1064137.5 850.9 / 0.080% 163757.8 / 15.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ede_crit 1064137
Earth Shock 109866 10.3% 16.5 17.52sec 2000847 2066596 Direct 16.5 1399609 3947639 2000906 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.9682 0.0000 32968402.09 32968402.09 0.00 2066595.76 2066595.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.59 76.40% 1399608.57 1135077 1669384 1400073.08 1248494 1555212 17619954 17619954 0.00
crit 3.89 23.60% 3947638.57 3200916 4707662 3893355.28 0 4707662 15348448 15348448 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63695 (97303) 6.0% (9.2%) 22.1 13.75sec 1320589 996324 Direct 22.0 609235 1718577 866600 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.05 0.00 0.00 1.3255 0.0000 19104155.95 19104155.95 0.00 996324.22 996324.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.93 76.80% 609234.96 521261 680768 609349.30 567956 645867 10315832 10315832 0.00
crit 5.11 23.20% 1718576.59 1469956 1919766 1711084.19 0 1919766 8788324 8788324 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33608 3.2% 13.9 21.15sec 722849 0 Direct 13.9 511677 1442885 724599 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 10078180.40 10078180.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.73 77.13% 511677.12 437859 571845 511763.98 456662 560393 5488675 5488675 0.00
crit 3.18 22.87% 1442885.14 1234763 1612604 1391574.60 0 1612604 4589506 4589506 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61966 5.8% 11.2 27.76sec 1657026 1727787 Direct 11.2 91995 259729 130927 23.2%  
Periodic 236.3 50958 143691 72426 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 236.25 236.25 0.9591 1.2623 18578891.14 18578891.14 0.00 60128.97 1727786.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.61 76.78% 91994.51 77837 101655 91993.44 83988 99009 791998 791998 0.00
crit 2.60 23.22% 259728.81 219500 286667 244882.18 0 286667 676081 676081 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.6 76.85% 50958.19 42 55911 50961.52 47311 52767 9252024 9252024 0.00
crit 54.7 23.15% 143690.70 429 157670 143699.08 132475 150049 7858788 7858788 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 124315 11.7% 38.4 7.53sec 970932 1015962 Direct 38.4 678719 1915626 970895 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 0.9557 0.0000 37254307.64 37254307.64 0.00 1015961.92 1015961.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 76.38% 678719.22 572934 770114 679115.27 635877 723418 19890016 19890016 0.00
crit 9.06 23.62% 1915625.63 1662882 2171723 1914262.96 0 2171723 17364291 17364291 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35506 (54474) 3.3% (5.1%) 9.7 32.11sec 1683808 1322876 Direct 9.7 771295 2176136 1100337 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.68 0.00 0.00 1.2729 0.0000 10646079.29 10646079.29 0.00 1322876.48 1322876.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.58% 771295.09 663371 866364 771428.69 673257 852484 5715041 5715041 0.00
crit 2.27 23.42% 2176135.86 1870706 2443146 2013996.38 0 2443146 4931039 4931039 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18967 1.8% 6.2 47.01sec 921114 0 Direct 6.2 647851 1825562 923071 23.4%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.16 0.00 0.00 0.0000 0.0000 5684830.88 5684830.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.72 76.63% 647850.87 557231 727745 646665.60 0 727745 3057566 3057566 0.00
crit 1.44 23.37% 1825561.66 1571393 2052242 1440689.35 0 2052242 2627264 2627264 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 159248 (248924) 15.0% (23.4%) 59.1 5.04sec 1263801 1082933 Direct 58.9 0 810599 810599 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.07 58.92 0.00 0.00 1.1670 0.0000 47758175.40 47758175.40 0.00 1082932.78 1082932.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.92 100.00% 810599.13 706308 922440 810680.84 778011 843467 47758175 47758175 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81591 7.7% 37.6 7.86sec 651403 0 Direct 37.4 0 653462 653462 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.45 0.00 0.00 0.0000 0.0000 24469023.16 24469023.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.45 100.00% 653461.82 569500 743768 653543.50 614477 692820 24469023 24469023 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8086 0.8% 43.7 6.13sec 55430 0 Direct 43.7 44707 91207 55430 23.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.74 43.74 0.00 0.00 0.0000 0.0000 2424772.83 2424772.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.66 76.94% 44707.09 42943 47934 44716.15 42943 46730 1504726 1504726 0.00
crit 10.09 23.06% 91206.58 87603 97785 91171.55 0 97785 920047 920047 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 123626 (226385) 11.6% (21.3%) 97.1 3.00sec 698748 581069 Direct 97.1 237183 672206 381571 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.12 97.12 0.00 0.00 1.2025 0.0000 37056742.49 37056742.49 0.00 581068.89 581068.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.88 66.81% 237183.21 154272 604437 237479.77 194548 290265 15389219 15389219 0.00
crit 32.23 33.19% 672206.31 435046 1704513 672608.25 494659 939932 21667523 21667523 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 102759 9.7% 94.4 3.76sec 326249 0 Direct 94.4 202721 574023 326244 33.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.41 94.41 0.00 0.00 0.0000 0.0000 30802806.98 30802806.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.01 66.73% 202721.26 129588 507727 202803.47 149390 265963 12772534 12772534 0.00
crit 31.41 33.27% 574022.75 365439 1431791 574127.96 414368 872689 18030273 18030273 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59368) 0.0% (5.5%) 3.0 120.38sec 5925974 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.70 0.00 0.0000 1.0000 0.00 0.00 0.00 306468.71 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 18970 1.8% 37.5 6.98sec 150633 0 Direct 37.4 121869 248614 151210 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.50 37.36 0.00 0.00 0.0000 0.0000 5649404.98 5649404.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.71 76.85% 121869.49 121869 121869 121869.49 121869 121869 3499166 3499166 0.00
crit 8.65 23.15% 248613.77 248614 248614 248561.33 0 248614 2150239 2150239 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40399 3.8% 98.5 2.62sec 122119 0 Direct 98.3 98655 201256 122417 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.54 98.30 0.00 0.00 0.0000 0.0000 12034145.89 12034145.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.54 76.84% 98654.92 98655 98655 98654.92 98655 98655 7451995 7451995 0.00
crit 22.77 23.16% 201256.04 201256 201256 201256.04 201256 201256 4582151 4582151 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143784 / 55069
Fire Blast 143784 5.1% 62.8 4.31sec 261382 146350 Direct 62.8 212287 424645 261381 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.80 62.80 0.00 0.00 1.7860 0.0000 16414618.08 16414618.08 0.00 146350.02 146350.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.28 76.88% 212286.63 199011 222144 212287.25 207585 219416 10249385 10249385 0.00
crit 14.52 23.12% 424645.00 398022 444288 424635.69 412258 444288 6165233 6165233 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186588 / 26466
Lightning Blast 186588 2.5% 41.9 6.73sec 189289 202449 Direct 41.9 153583 307231 189286 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.86 41.86 0.00 0.00 0.9350 0.0000 7923435.33 7923435.33 0.00 202448.65 202448.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.13 76.76% 153583.32 147415 164551 153616.98 148779 161076 4934862 4934862 0.00
crit 9.73 23.24% 307230.63 294831 329102 307254.88 0 329102 2988573 2988573 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ede_crit
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0344 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.8209 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.21sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5213 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.1sec 32.10% 32.10% 3.1(3.1) 7.9

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.0sec 69.0sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.6sec 34.94% 34.94% 1.4(1.4) 10.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.5 27.2sec 23.6sec 34.79% 34.79% 1.5(1.5) 10.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.5sec 33.78% 33.78% 1.8(1.8) 9.9

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.1 30.2 4.1sec 2.9sec 60.75% 63.32% 30.2(36.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.64%
  • elemental_focus_2:35.11%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.29% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.36%
  • icefury_2:5.87%
  • icefury_3:4.95%
  • icefury_4:3.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.3 13.0sec 12.2sec 10.28% 39.73% 1.3(1.3) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.28%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.6

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.4sec 69.4sec 13.52% 13.52% 0.0(0.0) 3.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.52%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.3sec 0.0sec 39.84% 39.84% 0.0(0.0) 1.7

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.8sec 30.4sec 21.65% 23.91% 1.4(2.9) 0.1

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:9.21%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.50% 8.78% 0.0(0.0) 0.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.26%
  • stormkeeper_2:3.69%
  • stormkeeper_3:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 77.5sec
Lava Surge: During Lava Burst 3.7 57.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6810.0014.1992.4450.00010.729
Fire Elemental0.3440.0011.2480.0920.0001.248
Lava Burst0.8950.0018.2097.2940.00024.216
Elemental Blast0.5300.0014.4518.8042.57917.352
Icefury0.9830.0018.1447.2030.26320.872

Resources

Resource Usage Type Count Total Average RPE APR
ede_crit
earth_shock Maelstrom 135.2 16216.4 120.0 984.2 2033.0
flame_shock Maelstrom 92.0 1643.3 17.9 146.6 11305.7
frost_shock Maelstrom 314.7 6294.5 20.0 164.0 5918.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 484.52 5750.53 (23.38%) 11.87 63.67 1.10%
Lava Burst Overload Maelstrom 308.12 2672.78 (10.87%) 8.67 100.29 3.62%
Lightning Bolt Maelstrom 796.56 6355.93 (25.84%) 7.98 16.58 0.26%
Lightning Bolt Overload Maelstrom 774.43 4591.66 (18.67%) 5.93 54.89 1.18%
Icefury Maelstrom 79.55 1897.60 (7.72%) 23.85 11.69 0.61%
Icefury Overload Maelstrom 50.62 901.82 (3.67%) 17.81 9.41 1.03%
Resonance Totem Maelstrom 2448.07 2425.15 (9.86%) 0.99 22.92 0.94%
Resource RPS-Gain RPS-Loss
Maelstrom 9.99 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.51 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ede_crit Fight Length
Count 9482
Mean 300.01
Minimum 239.97
Maximum 360.03
Spread ( max - min ) 120.06
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.9603
5th Percentile 245.09
95th Percentile 354.89
( 95th Percentile - 5th Percentile ) 109.80
Mean Distribution
Standard Deviation 0.3693
95.00% Confidence Intervall ( 299.29 - 300.73 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 552
0.1% Error 55192
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1104
DPS
Sample Data ede_crit Damage Per Second
Count 9482
Mean 1064137.48
Minimum 913839.13
Maximum 1237956.44
Spread ( max - min ) 324117.31
Range [ ( max - min ) / 2 * 100% ] 15.23%
Standard Deviation 42273.9833
5th Percentile 996270.61
95th Percentile 1135529.69
( 95th Percentile - 5th Percentile ) 139259.08
Mean Distribution
Standard Deviation 434.1334
95.00% Confidence Intervall ( 1063286.60 - 1064988.37 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6063
0.1 Scale Factor Error with Delta=300 15255626
0.05 Scale Factor Error with Delta=300 61022502
0.01 Scale Factor Error with Delta=300 1525562527
Priority Target DPS
Sample Data ede_crit Priority Target Damage Per Second
Count 9482
Mean 1064137.48
Minimum 913839.13
Maximum 1237956.44
Spread ( max - min ) 324117.31
Range [ ( max - min ) / 2 * 100% ] 15.23%
Standard Deviation 42273.9833
5th Percentile 996270.61
95th Percentile 1135529.69
( 95th Percentile - 5th Percentile ) 139259.08
Mean Distribution
Standard Deviation 434.1334
95.00% Confidence Intervall ( 1063286.60 - 1064988.37 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6063
0.1 Scale Factor Error with Delta=300 15255626
0.05 Scale Factor Error with Delta=300 61022502
0.01 Scale Factor Error with Delta=300 1525562527
DPS(e)
Sample Data ede_crit Damage Per Second (Effective)
Count 9482
Mean 1064137.48
Minimum 913839.13
Maximum 1237956.44
Spread ( max - min ) 324117.31
Range [ ( max - min ) / 2 * 100% ] 15.23%
Damage
Sample Data ede_crit Damage
Count 9482
Mean 294509919.13
Minimum 207268747.50
Maximum 383794893.01
Spread ( max - min ) 176526145.52
Range [ ( max - min ) / 2 * 100% ] 29.97%
DTPS
Sample Data ede_crit Damage Taken Per Second
Count 9482
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ede_crit Healing Per Second
Count 9482
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ede_crit Healing Per Second (Effective)
Count 9482
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ede_crit Heal
Count 9482
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ede_crit Healing Taken Per Second
Count 9482
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ede_crit Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ede_critTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ede_crit Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.03 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.18 totem_mastery,if=buff.resonance_totem.remains<2
9 2.06 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.08 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.33 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.50 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.89 elemental_blast
Keep your EB always on Cooldown.
I 12.70 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.54 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 10.05 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.69 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 61.08 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 33.07 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.23 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.29 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.08 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.28 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 76.51 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMMNNNNSSSSMHFSSSPSMSSSSSHMPSSMKNNNMNSOHSSSMMSSPMSHMMJSSSPKMMHMNNNMFNSSSHMMPSSSSMSMHKGMNNNRFRMHQRRIRMSSAJSSHMLIRKNMNNFHRMNSSSMSMIHMRRRMSOKGNHMNNRRRMIRRHRJMLLILOMSSHKNMNNNRRRMMHISSSSMMSMI97SSHMOQKNMNNNRHRMRASPJSMMOSHSSSSMISSSKNNMHNMNSMMSSSISMHMSMRORPMRHKNMNNNSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.964 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.136 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.038 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.856 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
0:08.671 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:09.488 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:10.304 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.121 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:11.922 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.722 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.788 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.852 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.024 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.822 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.887 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.974 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.061 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.879 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.965 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.050 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.115 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.181 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.247 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.312 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.379 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.447 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.534 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.350 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.435 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.523 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.340 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.426 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:36.242 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:37.059 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:37.876 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.963 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.780 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.868 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.683 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.095 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.506 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.917 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.328 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.385 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.795 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.176 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.560 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.599 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.021 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.404 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.443 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.827 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.038 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.077 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.116 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.155 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.216 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.834 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.894 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:09.303 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:10.809 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:11.869 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:12.928 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:13.988 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:15.047 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:16.457 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:17.516 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:18.575 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.986 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.399 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.812 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.234 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.580 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.573 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.894 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.215 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.535 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.881 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.228 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.576 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.637 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.048 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.394 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:40.404 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:41.750 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:42.760 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:43.770 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:44.781 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:46.125 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:47.135 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:48.482 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:49.866 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:51.429 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.183 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.504 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:54.824 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:55.815 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:57.134 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:58.453 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:59.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:01.093 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:01.093 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:02.083 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:03.122 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.181 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.592 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.004 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.063 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.123 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:10.535 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.947 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:13.008 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:14.419 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:15.479 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:16.537 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:17.597 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:19.010 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:20.423 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:21.834 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
2:22.894 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.306 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.719 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.131 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.191 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.602 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.663 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.724 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.106 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.426 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.745 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:37.066 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.412 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.757 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.104 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.115 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.463 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:44.522 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:45.581 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:46.992 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:48.404 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:49.463 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:50.522 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.933 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.345 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.755 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.166 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.226 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.639 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.051 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.464 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.810 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.820 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.166 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.176 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.187 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.198 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.208 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.217 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.562 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.973 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.385 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.798 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.209 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.268 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:19.681 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
3:20.719 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
3:21.757 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:22.795 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.179 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.563 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:26.546 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:27.530 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:28.284 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:29.266 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:30.020 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:30.956 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:31.893 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:32.828 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:33.765 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:34.702 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:35.458 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:36.392 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.145 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:37.899 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:39.168 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:39.168 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:40.722 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:42.349 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:43.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:45.636 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:46.676 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:47.430 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.814 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
3:49.852 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:51.236 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:52.274 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:53.332 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:54.392 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.803 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.386 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:58.733 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.080 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.426 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.426 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:02.772 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:03.783 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.825 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:05.835 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.182 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.192 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:08.946 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:09.700 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:10.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:11.438 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:12.418 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:13.403 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:14.385 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:15.368 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:16.123 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:17.106 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:18.089 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:19.072 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:20.054 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:20.808 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:22.053 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:23.679 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:25.306 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:26.528 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:27.751 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:28.999 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:29.982 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:30.965 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:31.719 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:32.683 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:33.646 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:34.609 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:35.363 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:36.327 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:37.081 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:38.284 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:39.267 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:40.251 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:41.007 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:42.666 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:43.911 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:45.571 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:46.816 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:48.476 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:50.136 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.693 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.106 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:54.117 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:55.462 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:56.472 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:57.483 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:58.493 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.838 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ede_crit"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:5:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

edi_cl : 1053023 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1053022.9 1053022.9 841.5 / 0.080% 163120.4 / 15.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
edi_cl 1053023
Earth Shock 108494 10.3% 16.5 17.52sec 1973685 2038996 Direct 16.5 1399699 3871629 1973561 23.2%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9680 0.0000 32548490.25 32548490.25 0.00 2038995.82 2038995.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.66 76.78% 1399699.03 1135077 1669384 1400091.83 1247947 1547327 17723056 17723056 0.00
crit 3.83 23.22% 3871629.36 3141892 4620854 3815460.61 0 4620854 14825434 14825434 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62823 (96190) 6.0% (9.1%) 22.1 13.75sec 1305213 984966 Direct 22.0 609097 1686287 854730 22.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.04 0.00 0.00 1.3252 0.0000 18840800.51 18840800.51 0.00 984965.95 984965.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.02 77.20% 609097.02 521261 680768 609193.46 567087 652510 10364526 10364526 0.00
crit 5.03 22.80% 1686286.66 1442850 1884366 1680949.31 0 1884366 8476274 8476274 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33366 3.2% 14.0 21.17sec 716607 0 Direct 13.9 511647 1416072 718423 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.93 0.00 0.00 0.0000 0.0000 10003927.28 10003927.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.74 77.14% 511647.09 437859 571845 511768.68 460577 559630 5496767 5496767 0.00
crit 3.18 22.86% 1416072.23 1211994 1582868 1369005.72 0 1582868 4507161 4507161 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61403 5.8% 11.2 27.76sec 1641513 1710574 Direct 11.2 92026 254997 129496 23.0%  
Periodic 236.3 50967 141082 71769 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 236.27 236.27 0.9597 1.2622 18409202.69 18409202.69 0.00 59579.79 1710574.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.64 77.01% 92026.33 77837 101655 92011.76 83691 101655 794807 794807 0.00
crit 2.58 22.99% 254997.08 215453 281381 240747.67 0 281381 657396 657396 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.7 76.92% 50966.56 103 55911 50968.07 46381 52817 9262304 9262304 0.00
crit 54.5 23.08% 141082.33 359 154763 141082.71 128404 148129 7694696 7694696 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123108 11.7% 38.4 7.54sec 961606 1005954 Direct 38.4 678695 1879817 961617 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 0.9559 0.0000 36894376.20 36894376.20 0.00 1005954.20 1005954.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.33 76.45% 678694.53 589674 770114 679080.22 643030 736147 19906439 19906439 0.00
crit 9.04 23.55% 1879816.76 1503105 2131677 1878140.14 0 2103218 16987937 16987937 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35164 (54004) 3.3% (5.1%) 9.7 32.13sec 1668505 1310428 Direct 9.7 771081 2134355 1088723 23.3%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.68 0.00 0.00 1.2733 0.0000 10540136.78 10540136.78 0.00 1310427.53 1310427.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.43 76.70% 771081.08 663371 866364 771176.33 663371 849014 5725381 5725381 0.00
crit 2.26 23.30% 2134355.46 1836210 2398095 1974701.11 0 2398095 4814756 4814756 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18840 1.8% 6.2 47.42sec 910049 0 Direct 6.2 647933 1791598 912571 23.1%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.21 6.19 0.00 0.00 0.0000 0.0000 5648884.91 5648884.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.76 76.87% 647933.18 557231 727745 647094.62 0 727745 3083125 3083125 0.00
crit 1.43 23.13% 1791598.42 1542417 2014400 1412801.04 0 2014400 2565760 2565760 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156462 (245026) 14.9% (23.3%) 59.2 5.01sec 1241763 1064333 Direct 59.0 0 794834 794834 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.17 59.03 0.00 0.00 1.1667 0.0000 46915911.18 46915911.18 0.00 1064332.93 1064332.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.03 100.00% 794833.72 692614 904556 794911.48 762743 836706 46915911 46915911 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80417 7.6% 37.7 7.85sec 640117 0 Direct 37.6 0 642018 642018 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.56 0.00 0.00 0.0000 0.0000 24112721.46 24112721.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.56 100.00% 642017.61 559584 730817 642076.02 605782 680208 24112721 24112721 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8147 0.8% 44.0 6.18sec 55482 0 Direct 44.0 44706 91199 55483 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.04 44.04 0.00 0.00 0.0000 0.0000 2443334.15 2443334.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.83 76.82% 44706.21 42943 47934 44718.82 42943 47327 1512474 1512474 0.00
crit 10.21 23.18% 91198.79 87603 97785 91171.07 0 97785 930860 930860 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122185 (223645) 11.6% (21.2%) 97.1 3.01sec 690647 574601 Direct 97.1 237308 659776 377327 33.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.06 97.06 0.00 0.00 1.2020 0.0000 36621198.06 36621198.06 0.00 574601.38 574601.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.89 66.86% 237308.05 154272 604437 237587.07 197501 284650 15399417 15399417 0.00
crit 32.17 33.14% 659776.19 427024 1673082 660045.38 485630 954812 21221781 21221781 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101460 9.6% 94.2 3.77sec 322732 0 Direct 94.2 202913 564216 322731 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.23 94.23 0.00 0.00 0.0000 0.0000 30410650.02 30410650.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.98 66.84% 202913.27 129588 507727 203002.78 157697 253056 12779719 12779719 0.00
crit 31.25 33.16% 564216.07 358700 1405389 564326.23 407141 826128 17630931 17630931 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59461) 0.0% (5.6%) 3.0 120.38sec 5936652 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.73 0.00 0.0000 1.0000 0.00 0.00 0.00 306748.66 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19045 1.8% 37.6 6.93sec 150641 0 Direct 37.5 121869 248614 151198 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.64 37.50 0.00 0.00 0.0000 0.0000 5670434.52 5670434.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.82 76.86% 121869.49 121869 121869 121869.49 121869 121869 3512848 3512848 0.00
crit 8.68 23.14% 248613.77 248614 248614 248587.33 0 248614 2157587 2157587 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40415 3.8% 98.6 2.62sec 122084 0 Direct 98.4 98655 201256 122379 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.59 98.36 0.00 0.00 0.0000 0.0000 12036631.83 12036631.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.61 76.88% 98654.92 98655 98655 98654.92 98655 98655 7459571 7459571 0.00
crit 22.74 23.12% 201256.04 201256 201256 201256.04 201256 201256 4577061 4577061 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143948 / 55152
Fire Blast 143948 5.2% 62.9 4.30sec 261469 146511 Direct 62.9 212270 424583 261472 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.87 62.87 0.00 0.00 1.7847 0.0000 16437315.00 16437315.00 0.00 146510.58 146510.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.30 76.83% 212270.35 199011 222144 212264.83 207504 219662 10252103 10252103 0.00
crit 14.57 23.17% 424582.57 398022 444288 424564.90 412258 444288 6185212 6185212 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186778 / 26540
Lightning Blast 186778 2.5% 41.9 6.73sec 189450 202589 Direct 41.9 153581 307215 189450 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.93 41.93 0.00 0.00 0.9352 0.0000 7943301.55 7943301.55 0.00 202588.73 202588.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.14 76.65% 153581.06 147415 164551 153614.51 149197 161022 4935991 4935991 0.00
crit 9.79 23.35% 307215.14 294831 329102 307253.99 294831 329102 3007310 3007310 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
edi_cl
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0334 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8216 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.06sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5210 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.13% 32.13% 3.1(3.1) 7.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.7sec 68.7sec 8.72% 8.72% 0.0(0.0) 3.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.72%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.5 1.4 27.2sec 23.7sec 34.80% 34.80% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.6sec 34.82% 34.82% 1.4(1.4) 10.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.8sec 23.3sec 33.95% 33.95% 1.8(1.8) 9.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.1 4.1sec 2.9sec 60.60% 63.23% 30.1(36.1) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.55%
  • elemental_focus_2:35.05%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.32% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.37%
  • icefury_2:5.86%
  • icefury_3:4.95%
  • icefury_4:3.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.4 1.3 12.9sec 12.2sec 10.36% 39.90% 1.3(1.3) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.36%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.0 4.2 23.0sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.7

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.1sec 69.1sec 13.56% 13.56% 0.0(0.0) 3.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.56%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.3sec 0.0sec 39.84% 39.84% 0.0(0.0) 1.7

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.7sec 30.3sec 21.65% 23.96% 1.4(2.9) 0.1

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.19%
  • power_of_the_maelstrom_2:6.24%
  • power_of_the_maelstrom_3:9.21%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.55% 8.81% 0.0(0.0) 0.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.72%
  • stormkeeper_3:4.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 78.4sec
Lava Surge: During Lava Burst 3.7 58.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6850.0014.3072.4740.0008.604
Fire Elemental0.3470.0011.2480.0920.0001.248
Lava Burst0.8960.0019.0087.3090.00024.715
Elemental Blast0.5320.0014.1148.8312.01218.546
Icefury0.9920.0018.0967.2300.76524.267

Resources

Resource Usage Type Count Total Average RPE APR
edi_cl
earth_shock Maelstrom 135.8 16294.3 120.0 988.1 1997.5
flame_shock Maelstrom 92.4 1651.0 17.9 147.2 11150.2
frost_shock Maelstrom 316.0 6319.5 20.0 164.7 5838.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 487.27 5784.08 (23.41%) 11.87 63.16 1.08%
Lava Burst Overload Maelstrom 310.22 2691.77 (10.89%) 8.68 100.21 3.59%
Lightning Bolt Maelstrom 799.28 6377.46 (25.81%) 7.98 16.81 0.26%
Lightning Bolt Overload Maelstrom 776.00 4601.58 (18.62%) 5.93 54.40 1.17%
Icefury Maelstrom 79.91 1906.08 (7.71%) 23.85 11.70 0.61%
Icefury Overload Maelstrom 51.12 910.97 (3.69%) 17.82 9.25 1.01%
Resonance Totem Maelstrom 2457.89 2434.92 (9.86%) 0.99 22.97 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.22 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data edi_cl Fight Length
Count 9405
Mean 300.00
Minimum 239.94
Maximum 360.06
Spread ( max - min ) 120.12
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.1205
5th Percentile 245.32
95th Percentile 354.67
( 95th Percentile - 5th Percentile ) 109.36
Mean Distribution
Standard Deviation 0.3725
95.00% Confidence Intervall ( 299.27 - 300.73 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 557
0.1% Error 55687
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1114
DPS
Sample Data edi_cl Damage Per Second
Count 9405
Mean 1053022.89
Minimum 910784.39
Maximum 1231076.72
Spread ( max - min ) 320292.32
Range [ ( max - min ) / 2 * 100% ] 15.21%
Standard Deviation 41636.0414
5th Percentile 987055.24
95th Percentile 1123652.38
( 95th Percentile - 5th Percentile ) 136597.14
Mean Distribution
Standard Deviation 429.3288
95.00% Confidence Intervall ( 1052181.42 - 1053864.36 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6006
0.1 Scale Factor Error with Delta=300 14798665
0.05 Scale Factor Error with Delta=300 59194659
0.01 Scale Factor Error with Delta=300 1479866475
Priority Target DPS
Sample Data edi_cl Priority Target Damage Per Second
Count 9405
Mean 1053022.89
Minimum 910784.39
Maximum 1231076.72
Spread ( max - min ) 320292.32
Range [ ( max - min ) / 2 * 100% ] 15.21%
Standard Deviation 41636.0414
5th Percentile 987055.24
95th Percentile 1123652.38
( 95th Percentile - 5th Percentile ) 136597.14
Mean Distribution
Standard Deviation 429.3288
95.00% Confidence Intervall ( 1052181.42 - 1053864.36 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6006
0.1 Scale Factor Error with Delta=300 14798665
0.05 Scale Factor Error with Delta=300 59194659
0.01 Scale Factor Error with Delta=300 1479866475
DPS(e)
Sample Data edi_cl Damage Per Second (Effective)
Count 9405
Mean 1053022.89
Minimum 910784.39
Maximum 1231076.72
Spread ( max - min ) 320292.32
Range [ ( max - min ) / 2 * 100% ] 15.21%
Damage
Sample Data edi_cl Damage
Count 9405
Mean 291096699.85
Minimum 208997431.00
Maximum 374288943.80
Spread ( max - min ) 165291512.80
Range [ ( max - min ) / 2 * 100% ] 28.39%
DTPS
Sample Data edi_cl Damage Taken Per Second
Count 9405
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data edi_cl Healing Per Second
Count 9405
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data edi_cl Healing Per Second (Effective)
Count 9405
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data edi_cl Heal
Count 9405
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data edi_cl Healing Taken Per Second
Count 9405
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data edi_cl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data edi_clTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data edi_cl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.05 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.05 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.29 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.51 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.70 elemental_blast
Keep your EB always on Cooldown.
I 12.61 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.50 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.97 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.71 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.68 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.73 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.18 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.26 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.05 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.09 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.81 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNSNSMSOMSHSMSSIMMMRRRISHMSSSSKGGMGMMGMIHRRORMSSMIMHSSJMSSSKGNHMMGNOSSMSIHSMMRMMRPRMHKNNNMNORRRHMMMQRIRMRAJMSHSSPMSOKNNSNMNHSSSMSSSPSMHSSSSSPMSKNMNHFMMNNMSSMSHISJMLLLMOSSHIKMMNNNNSSM97HSSSMSSISSMHOQSKNMMNNNSHMSASSIJSMSOSHSMMPSKNNMSHNMNSMSSSSMHIMSOSSMSSSKGGHMGMGSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.965 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.002 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:05.039 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.076 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:06.854 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:07.632 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:08.410 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.186 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.965 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.743 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, lava_surge, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.521 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.299 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.077 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.166 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.252 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.338 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.354 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.118 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.133 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.150 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.915 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.679 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.696 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.474 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.510 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.527 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.544 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.343 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.408 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.474 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.491 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.528 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.544 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.560 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:34.314 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:35.068 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:35.822 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:36.578 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:37.332 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
0:38.086 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:38.841 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:39.596 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
0:40.349 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.106 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:41.861 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:42.843 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:43.826 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:44.807 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:45.563 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:47.223 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:48.848 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:50.475 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:52.102 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:53.323 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.362 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.746 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.129 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.513 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.896 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.040 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.483 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.542 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.601 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.013 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.072 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:09.132 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:10.545 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:11.583 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:12.967 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:14.006 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:15.045 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.082 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.465 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.877 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.288 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.699 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.758 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:24.143 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.527 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.564 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:27.947 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:29.331 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.392 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.452 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.864 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.924 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.337 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.748 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.160 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.570 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:40.630 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:41.688 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:42.745 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:44.159 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:45.216 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.275 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.688 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.100 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.511 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.922 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.270 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.280 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.291 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.045 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.392 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.403 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.750 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:00.686 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:01.624 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:01.624 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:02.379 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:03.133 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:03.887 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:04.901 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:05.655 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:06.409 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:07.165 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:08.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:09.018 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:09.772 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:10.690 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw
2:11.444 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, mark_of_the_claw
2:12.200 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw
2:13.754 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, mark_of_the_claw
2:14.920 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
2:16.504 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, mark_of_the_claw
2:17.726 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:19.353 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:20.982 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.302 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:23.622 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.966 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.311 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.657 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.003 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.014 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:30.995 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:31.978 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:32.961 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:33.943 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:34.926 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:35.909 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:36.892 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:37.877 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:38.630 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.596 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.667 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
2:42.422 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due
2:43.668 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), devils_due
2:44.914 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due
2:46.615 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due
2:47.862 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due
2:49.108 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due
2:50.768 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:51.828 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:52.888 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.948 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.361 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.772 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.596 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.007 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.018 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.367 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.377 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.386 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.379 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.370 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.362 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.682 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.674 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.022 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.434 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.846 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.856 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.203 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:18.213 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:19.559 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:20.568 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:21.580 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:22.592 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:23.602 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.949 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.359 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.770 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.060 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.060 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:30.473 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:31.818 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:33.137 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:34.459 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:35.780 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:37.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:38.420 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:39.410 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:40.730 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.052 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:43.436 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:44.849 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:45.908 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.663 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:48.073 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:49.484 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
3:50.544 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:51.603 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:53.015 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
3:54.074 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:55.134 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:56.193 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.603 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:59.013 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:00.359 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.680 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.680 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.002 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.323 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:05.314 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:06.305 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:07.316 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:08.662 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:09.673 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:10.732 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:11.793 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:13.204 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:14.616 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:16.028 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:17.087 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:18.145 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.557 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.969 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:22.029 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), potion_of_prolonged_power
4:23.089 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
4:24.500 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
4:25.911 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
4:27.295 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
4:28.288 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
4:29.279 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
4:30.271 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.591 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.911 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.257 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.604 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.951 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.297 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.356 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.769 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.829 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.238 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.649 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:45.401 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.384 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:47.368 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:48.349 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:49.331 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:50.313 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:51.294 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:52.276 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact
4:53.030 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact
4:53.785 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:54.768 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:55.522 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact
4:56.276 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact
4:57.213 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due
4:58.401 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:59.983 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Spell Speed 39.30% 18.38% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="edi_cl"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:5:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

fs_fs : 1057553 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1057553.4 1057553.4 845.5 / 0.080% 163192.6 / 15.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fs_fs 1057553
Earth Shock 108814 10.3% 16.5 17.51sec 1979291 2044848 Direct 16.5 1399671 3876134 1979145 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 0.9680 0.0000 32637812.41 32637812.41 0.00 2044847.59 2044847.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.63 76.59% 1399670.72 1135077 1669384 1400111.38 1268662 1563738 17678031 17678031 0.00
crit 3.86 23.41% 3876134.10 3141892 4620854 3825219.21 0 4620854 14959782 14959782 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62906 (96292) 6.0% (9.1%) 22.1 13.76sec 1306978 986048 Direct 22.0 609397 1686467 855940 22.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3255 0.0000 18863861.22 18863861.22 0.00 986047.59 986047.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.00 77.11% 609397.44 521261 680768 609525.65 569326 651457 10356865 10356865 0.00
crit 5.04 22.89% 1686467.36 1442850 1884366 1680084.95 0 1884366 8506997 8506997 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33386 3.2% 14.0 21.18sec 717170 0 Direct 13.9 511795 1416420 718804 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.93 0.00 0.00 0.0000 0.0000 10012542.46 10012542.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.74 77.12% 511795.27 437859 571845 511921.00 460372 553522 5498291 5498291 0.00
crit 3.19 22.88% 1416419.95 1211994 1582868 1367421.34 0 1582868 4514251 4514251 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 65180 6.2% 11.2 27.79sec 1741242 1815153 Direct 11.2 97569 270696 137562 23.1%  
Periodic 236.3 54053 149605 76177 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.26 236.26 0.9593 1.2621 19541937.66 19541937.66 0.00 63250.09 1815153.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.63 76.90% 97568.75 82554 107816 97564.00 89624 106377 842027 842027 0.00
crit 2.59 23.10% 270695.91 228511 298435 255375.57 0 298435 701872 701872 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.6 76.85% 54053.35 40 59300 54058.30 50096 55895 9813687 9813687 0.00
crit 54.7 23.15% 149604.78 224 164142 149618.42 137122 157001 8184351 8184351 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123280 11.7% 38.4 7.54sec 963506 1008410 Direct 38.4 678890 1880357 963502 23.7%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.35 38.35 0.00 0.00 0.9555 0.0000 36953173.49 36953173.49 0.00 1008409.70 1008409.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.27 76.31% 678890.11 589674 770114 679283.74 637703 727023 19869296 19869296 0.00
crit 9.09 23.69% 1880357.16 1632219 2131677 1879005.83 1632219 2131677 17083878 17083878 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35209 (53962) 3.3% (5.1%) 9.7 32.12sec 1668196 1310612 Direct 9.7 771408 2136297 1091292 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2729 0.0000 10551954.21 10551954.21 0.00 1310611.91 1310611.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.56% 771407.68 663371 866364 771488.09 673257 854797 5709651 5709651 0.00
crit 2.27 23.44% 2136296.57 1836210 2398095 1966337.73 0 2398095 4842303 4842303 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18753 1.8% 6.2 46.98sec 910929 0 Direct 6.2 648019 1794321 913109 23.1%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.17 6.15 0.00 0.00 0.0000 0.0000 5619686.19 5619686.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.73 76.88% 648018.97 557231 727745 646665.48 0 727745 3066093 3066093 0.00
crit 1.42 23.12% 1794321.32 1542417 2014400 1400525.24 0 2014400 2553594 2553594 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156325 (244848) 14.8% (23.2%) 59.1 5.03sec 1242109 1064585 Direct 59.0 0 795004 795004 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.11 58.96 0.00 0.00 1.1668 0.0000 46873594.21 46873594.21 0.00 1064585.43 1064585.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.96 100.00% 795004.39 692614 904556 795084.41 761283 834835 46873594 46873594 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80352 7.6% 37.6 7.86sec 640212 0 Direct 37.5 0 642244 642244 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.64 37.52 0.00 0.00 0.0000 0.0000 24094433.28 24094433.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.52 100.00% 642243.89 559584 730817 642326.90 608714 679841 24094433 24094433 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8171 0.8% 44.2 6.19sec 55483 0 Direct 44.2 44714 91202 55483 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.16 44.16 0.00 0.00 0.0000 0.0000 2450041.80 2450041.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.93 76.83% 44713.83 42943 47934 44724.27 42943 47375 1517068 1517068 0.00
crit 10.23 23.17% 91201.70 87603 97785 91214.25 0 97785 932973 932973 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122316 (224105) 11.6% (21.2%) 97.1 3.01sec 691829 575484 Direct 97.1 237433 659011 377550 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.10 97.10 0.00 0.00 1.2022 0.0000 36658891.28 36658891.28 0.00 575483.61 575483.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.83 66.76% 237433.39 154272 604437 237714.85 193186 285496 15392027 15392027 0.00
crit 32.27 33.24% 659010.70 427024 1673082 659060.57 477833 918525 21266864 21266864 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101789 9.6% 94.5 3.76sec 322844 0 Direct 94.5 202808 564281 322846 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.52 94.52 0.00 0.00 0.0000 0.0000 30515583.53 30515583.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.13 66.79% 202808.16 129588 507727 202905.11 160628 271318 12803907 12803907 0.00
crit 31.39 33.21% 564280.60 358700 1405389 564292.08 401319 831269 17711676 17711676 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59425) 0.0% (5.6%) 3.0 120.38sec 5931101 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.68 0.00 0.0000 1.0000 0.00 0.00 0.00 306815.01 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19006 1.8% 37.6 6.94sec 150658 0 Direct 37.4 121869 248614 151254 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.42 0.00 0.00 0.0000 0.0000 5660100.78 5660100.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.75 76.82% 121869.49 121869 121869 121869.49 121869 121869 3503295 3503295 0.00
crit 8.68 23.18% 248613.77 248614 248614 248613.77 248614 248614 2156806 2156806 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40419 3.8% 98.6 2.62sec 122116 0 Direct 98.3 98655 201256 122422 23.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.58 98.33 0.00 0.00 0.0000 0.0000 12037909.34 12037909.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.55 76.84% 98654.92 98655 98655 98654.92 98655 98655 7453638 7453638 0.00
crit 22.78 23.16% 201256.04 201256 201256 201256.04 201256 201256 4584271 4584271 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 144033 / 55139
Fire Blast 144033 5.2% 62.8 4.31sec 261642 146611 Direct 62.8 212302 424688 261642 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.81 62.81 0.00 0.00 1.7846 0.0000 16433385.46 16433385.46 0.00 146611.46 146611.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.22 76.77% 212301.99 199011 222144 212304.25 207552 221046 10236687 10236687 0.00
crit 14.59 23.23% 424688.24 398022 444288 424687.47 411368 442390 6196699 6196699 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186580 / 26509
Lightning Blast 186580 2.5% 41.9 6.73sec 189270 202461 Direct 41.9 153612 307283 189272 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.93 41.93 0.00 0.00 0.9349 0.0000 7936072.81 7936072.81 0.00 202461.17 202461.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.20 76.80% 153612.19 147415 164551 153641.73 148636 160817 4946341 4946341 0.00
crit 9.73 23.20% 307282.91 294831 329102 307337.19 294831 329102 2989732 2989732 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
fs_fs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0344 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8211 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.11sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5216 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.28% 32.28% 3.1(3.1) 8.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.6sec 34.87% 34.87% 1.4(1.4) 10.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.2sec 23.7sec 34.93% 34.93% 1.4(1.4) 10.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.0sec 23.4sec 33.80% 33.80% 1.8(1.8) 9.9

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.2 4.1sec 2.9sec 60.66% 63.27% 30.2(36.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.58%
  • elemental_focus_2:35.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.30% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.34%
  • icefury_2:5.90%
  • icefury_3:4.93%
  • icefury_4:3.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.32% 39.79% 1.4(1.4) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.32%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.2sec 69.2sec 13.55% 13.55% 0.0(0.0) 3.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.55%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.2sec 0.0sec 39.85% 39.85% 0.0(0.0) 1.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.2sec 21.76% 24.07% 1.4(3.0) 0.1

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.30%
  • power_of_the_maelstrom_3:9.29%

Trigger Attempt Success

  • trigger_pct:15.12%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.55% 8.80% 0.0(0.0) 0.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.71%
  • stormkeeper_3:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.7 12.2sec
Lava Surge: Wasted 1.4 79.2sec
Lava Surge: During Lava Burst 3.7 57.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6830.0014.2522.4590.0009.199
Fire Elemental0.3290.0011.2490.0880.0001.249
Lava Burst0.8990.00111.2837.3360.00024.714
Elemental Blast0.5320.0014.6858.8292.80318.336
Icefury0.9890.0017.8287.1990.72122.761

Resources

Resource Usage Type Count Total Average RPE APR
fs_fs
earth_shock Maelstrom 135.9 16307.8 120.0 989.0 2001.4
flame_shock Maelstrom 92.5 1654.2 17.9 147.4 11813.5
frost_shock Maelstrom 316.2 6323.2 20.0 164.9 5844.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 487.27 5784.46 (23.39%) 11.87 62.77 1.07%
Lava Burst Overload Maelstrom 310.25 2691.18 (10.88%) 8.67 101.04 3.62%
Lightning Bolt Maelstrom 800.38 6386.58 (25.82%) 7.98 16.46 0.26%
Lightning Bolt Overload Maelstrom 779.16 4620.55 (18.68%) 5.93 54.42 1.16%
Icefury Maelstrom 79.91 1906.12 (7.71%) 23.85 11.82 0.62%
Icefury Overload Maelstrom 50.85 905.65 (3.66%) 17.81 9.73 1.06%
Resonance Totem Maelstrom 2460.18 2437.27 (9.85%) 0.99 22.91 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.67 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data fs_fs Fight Length
Count 9274
Mean 299.99
Minimum 239.97
Maximum 360.00
Spread ( max - min ) 120.03
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 36.1669
5th Percentile 245.30
95th Percentile 354.67
( 95th Percentile - 5th Percentile ) 109.37
Mean Distribution
Standard Deviation 0.3756
95.00% Confidence Intervall ( 299.25 - 300.72 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 559
0.1% Error 55837
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 45
0.01 Scale Factor Error with Delta=300 1117
DPS
Sample Data fs_fs Damage Per Second
Count 9274
Mean 1057553.45
Minimum 923564.41
Maximum 1253338.19
Spread ( max - min ) 329773.78
Range [ ( max - min ) / 2 * 100% ] 15.59%
Standard Deviation 41544.1389
5th Percentile 991938.86
95th Percentile 1127989.35
( 95th Percentile - 5th Percentile ) 136050.49
Mean Distribution
Standard Deviation 431.3961
95.00% Confidence Intervall ( 1056707.92 - 1058398.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5929
0.1 Scale Factor Error with Delta=300 14733408
0.05 Scale Factor Error with Delta=300 58933629
0.01 Scale Factor Error with Delta=300 1473340721
Priority Target DPS
Sample Data fs_fs Priority Target Damage Per Second
Count 9274
Mean 1057553.45
Minimum 923564.41
Maximum 1253338.19
Spread ( max - min ) 329773.78
Range [ ( max - min ) / 2 * 100% ] 15.59%
Standard Deviation 41544.1389
5th Percentile 991938.86
95th Percentile 1127989.35
( 95th Percentile - 5th Percentile ) 136050.49
Mean Distribution
Standard Deviation 431.3961
95.00% Confidence Intervall ( 1056707.92 - 1058398.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5929
0.1 Scale Factor Error with Delta=300 14733408
0.05 Scale Factor Error with Delta=300 58933629
0.01 Scale Factor Error with Delta=300 1473340721
DPS(e)
Sample Data fs_fs Damage Per Second (Effective)
Count 9274
Mean 1057553.45
Minimum 923564.41
Maximum 1253338.19
Spread ( max - min ) 329773.78
Range [ ( max - min ) / 2 * 100% ] 15.59%
Damage
Sample Data fs_fs Damage
Count 9274
Mean 292471521.87
Minimum 209676795.47
Maximum 386861501.03
Spread ( max - min ) 177184705.55
Range [ ( max - min ) / 2 * 100% ] 30.29%
DTPS
Sample Data fs_fs Damage Taken Per Second
Count 9274
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fs_fs Healing Per Second
Count 9274
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fs_fs Healing Per Second (Effective)
Count 9274
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fs_fs Heal
Count 9274
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fs_fs Healing Taken Per Second
Count 9274
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fs_fs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data fs_fsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fs_fs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.01 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.02 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.01 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.23 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.45 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.38 elemental_blast
Keep your EB always on Cooldown.
I 12.41 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.44 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.82 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.66 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 59.77 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.23 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.09 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.22 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.04 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.94 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 74.67 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMLLGLGMNNOSMHMPRRRSMSPSSSHSMSSSIKMNMNNNHMOSMSSSSSMHISJSMMSMSOKGGHMGNSMIMSSSSSHMPSSMSSSMMHIKNNMFMNMNQRHMRRSSAJMISSHOMSSKNNNMNSHSSMSPSSSSSMMHPRMMMORRKGGHMGMNMPSSMMRHJLLIMSOSSMSHKNNNMNSSSSHM97SMIMSOQSHSMSKNNNMNSHSASMRJILLSMHOSMRRMIRKNNNMHMNSMSSSMPSHSMOSSSSSMPSSHKNNNMM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:04.975 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:05.738 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:06.503 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:07.267 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:08.031 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:08.794 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:09.556 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
0:10.593 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
0:11.356 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:12.119 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.882 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.900 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.700 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.001 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.066 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.883 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.970 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.056 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.142 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.229 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.314 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.401 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.219 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.304 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.390 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.455 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.522 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.589 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.654 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.718 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.783 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.870 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.687 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.775 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:37.591 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:38.404 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:39.490 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:40.306 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:41.125 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.185 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.595 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.654 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.664 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.985 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:48.307 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.626 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.948 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.294 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.640 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.987 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.399 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.812 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.871 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.284 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.344 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.403 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.814 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.874 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.934 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.993 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.053 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.114 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.525 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:11.587 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:12.647 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:14.058 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:15.469 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:16.529 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:17.589 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.999 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:19.754 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:20.509 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:21.470 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:22.433 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:23.395 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:24.358 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:25.320 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:26.283 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:27.267 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:28.204 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:28.958 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:29.894 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
1:30.829 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:32.018 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:33.602 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
1:35.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:36.739 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:37.907 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
1:39.535 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:40.920 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:41.912 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:43.234 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:44.225 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:45.218 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:46.539 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:47.532 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:48.525 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:49.518 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:50.509 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:51.501 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:52.255 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:53.638 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:55.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:56.395 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:57.715 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:59.037 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:00.358 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.679 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.679 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:02.671 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:04.018 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:05.028 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:06.040 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:07.100 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:08.510 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:09.520 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:10.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:11.876 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:13.223 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:14.574 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
2:15.565 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:16.555 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:17.545 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:18.867 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:19.904 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:21.288 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.700 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.112 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.523 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:26.505 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:27.489 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:28.244 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:29.228 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:30.212 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:31.196 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:32.180 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:33.160 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:34.143 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:34.896 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:35.879 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:36.633 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:37.569 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:38.758 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:39.947 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:41.529 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:42.694 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:44.248 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
2:45.801 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.122 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
2:48.160 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:49.219 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:50.629 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:51.639 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:52.650 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:53.995 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw
2:54.986 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.978 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.969 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.611 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.959 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.018 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.431 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.842 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.853 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.863 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.874 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.886 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.233 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.243 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.253 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.600 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.946 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.360 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.772 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.184 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.531 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:21.541 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:22.553 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:23.562 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:24.909 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
3:25.901 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.222 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.541 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.862 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.245 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.658 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.068 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.127 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.127 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:36.539 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:37.598 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:38.657 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:40.068 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:41.478 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:42.537 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.292 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:44.704 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:46.117 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:47.530 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:48.942 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:50.354 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:51.909 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
3:52.947 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:53.986 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
3:55.024 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
3:56.407 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
3:57.445 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:58.829 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.212 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.624 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:01.624 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:02.971 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:04.318 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:05.662 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:06.858 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.869 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.879 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.891 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.901 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.314 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:13.698 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:14.688 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:16.009 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:17.001 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:18.320 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:19.256 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:20.196 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:20.951 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:21.887 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:22.842 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
4:23.596 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
4:24.351 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
4:25.104 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
4:25.859 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, potion_of_prolonged_power
4:26.842 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:27.803 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:28.557 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:29.519 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:30.274 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:31.235 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:32.864 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:34.524 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:36.185 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:37.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:39.092 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.503 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.913 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.297 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.336 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:45.298 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:46.261 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:47.223 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:48.185 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:49.166 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:50.149 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:50.904 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:51.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:52.830 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:53.793 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:54.712 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:55.467 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:56.222 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:57.389 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:58.941 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="fs_fs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:5:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

li_lvb : 1061007 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1061006.7 1061006.7 848.2 / 0.080% 165457.1 / 15.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
li_lvb 1061007
Earth Shock 109061 10.3% 16.5 17.50sec 1983148 2048950 Direct 16.5 1399934 3875112 1983291 23.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.50 16.50 0.00 0.00 0.9679 0.0000 32721728.95 32721728.95 0.00 2048949.84 2048949.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.61 76.44% 1399933.70 1135077 1669384 1400403.68 1238266 1549870 17656337 17656337 0.00
crit 3.89 23.56% 3875111.90 3141892 4620854 3820809.45 0 4620854 15065392 15065392 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63154 (96511) 6.0% (9.1%) 22.1 13.75sec 1309817 988052 Direct 22.0 609149 1686493 858960 23.2%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.04 0.00 0.00 1.3257 0.0000 18933944.77 18933944.77 0.00 988051.85 988051.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.93 76.82% 609149.28 521261 680768 609242.04 562710 652411 10314746 10314746 0.00
crit 5.11 23.18% 1686493.47 1442850 1884366 1681203.99 0 1884366 8619198 8619198 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33357 3.1% 13.9 21.11sec 717668 0 Direct 13.9 511587 1417397 719310 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 10006093.99 10006093.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.72 77.07% 511587.02 437859 571845 511701.69 460577 556576 5484794 5484794 0.00
crit 3.19 22.93% 1417396.67 1211994 1582868 1364112.04 0 1582868 4521300 4521300 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61446 5.8% 11.2 27.76sec 1642098 1712679 Direct 11.2 91978 254871 129705 23.2%  
Periodic 236.3 50942 141016 71805 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.33 236.33 0.9588 1.2619 18425004.04 18425004.04 0.00 59630.93 1712679.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 76.84% 91977.63 77837 101655 91971.19 84263 100637 792967 792967 0.00
crit 2.60 23.16% 254871.25 215453 281381 240532.63 0 281381 662458 662458 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.6 76.84% 50941.51 37 55911 50946.14 46965 52896 9250408 9250408 0.00
crit 54.7 23.16% 141016.00 296 154763 141026.94 129597 147421 7719171 7719171 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123196 11.6% 38.4 7.53sec 961681 1006058 Direct 38.4 678854 1879596 961639 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.40 38.40 0.00 0.00 0.9559 0.0000 36925364.86 36925364.86 0.00 1006058.49 1006058.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.35 76.45% 678854.14 589674 770114 679229.37 637007 723458 19926540 19926540 0.00
crit 9.04 23.55% 1879596.05 1264969 2131677 1878118.54 1632219 2131677 16998825 16998825 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35218 (54202) 3.3% (5.1%) 9.7 32.11sec 1673166 1315420 Direct 9.7 771230 2134316 1090018 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.71 9.68 0.00 0.00 1.2720 0.0000 10555379.15 10555379.15 0.00 1315420.15 1315420.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 76.61% 771229.96 663371 866364 771379.82 669302 857689 5721953 5721953 0.00
crit 2.26 23.39% 2134315.57 1836210 2398095 1968197.49 0 2398095 4833426 4833426 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18984 1.8% 6.2 47.01sec 916685 0 Direct 6.2 647700 1793093 918731 23.7%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.19 0.00 0.00 0.0000 0.0000 5686113.39 5686113.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.72 76.33% 647700.47 557231 727745 646664.79 0 727745 3059408 3059408 0.00
crit 1.46 23.67% 1793092.78 1542417 2014400 1424640.99 0 2014400 2626705 2626705 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 160504 (251234) 15.1% (23.7%) 59.1 5.03sec 1274647 1092505 Direct 59.0 0 816259 816259 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.11 58.97 0.00 0.00 1.1667 0.0000 48131829.99 48131829.99 0.00 1092505.21 1092505.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.97 100.00% 816259.07 711167 928785 816357.72 780459 855098 48131830 48131830 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 82611 7.8% 37.7 7.84sec 657414 0 Direct 37.6 0 659440 659440 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.58 0.00 0.00 0.0000 0.0000 24779112.74 24779112.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.58 100.00% 659440.30 574572 750393 659520.29 625440 695264 24779113 24779113 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8119 0.8% 43.9 6.16sec 55503 0 Direct 43.9 44701 91194 55502 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.87 43.87 0.00 0.00 0.0000 0.0000 2434771.51 2434771.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.68 76.77% 44700.64 42943 47934 44707.92 43183 46870 1505320 1505320 0.00
crit 10.19 23.23% 91193.52 87603 97785 91189.99 0 97785 929451 929451 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122446 (224096) 11.5% (21.1%) 97.1 3.01sec 691737 575571 Direct 97.1 237265 660564 377925 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.09 97.09 0.00 0.00 1.2018 0.0000 36695585.86 36695585.86 0.00 575570.83 575570.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.83 66.77% 237264.69 154272 604437 237532.26 196093 276859 15381045 15381045 0.00
crit 32.27 33.23% 660564.15 427024 1673082 660793.23 477084 993398 21314541 21314541 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101650 9.6% 94.4 3.77sec 322581 0 Direct 94.4 202667 563742 322571 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.45 94.45 0.00 0.00 0.0000 0.0000 30466622.77 30466622.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.08 66.79% 202667.31 129588 507727 202705.32 157047 259644 12784700 12784700 0.00
crit 31.36 33.21% 563742.14 358700 1405389 564061.71 405182 828204 17681923 17681923 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59560) 0.0% (5.6%) 3.0 120.38sec 5940987 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 57.80 0.00 0.0000 1.0000 0.00 0.00 0.00 306808.22 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19044 1.8% 37.6 6.99sec 150723 0 Direct 37.5 121869 248614 151295 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.62 37.48 0.00 0.00 0.0000 0.0000 5670732.33 5670732.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.78 76.78% 121869.49 121869 121869 121869.49 121869 121869 3507070 3507070 0.00
crit 8.70 23.22% 248613.77 248614 248614 248561.03 0 248614 2163662 2163662 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40516 3.8% 98.8 2.62sec 122100 0 Direct 98.6 98655 201256 122390 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.80 98.57 0.00 0.00 0.0000 0.0000 12064009.82 12064009.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.77 76.87% 98654.92 98655 98655 98654.92 98655 98655 7474868 7474868 0.00
crit 22.80 23.13% 201256.04 201256 201256 201256.04 201256 201256 4589142 4589142 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143880 / 55144
Fire Blast 143880 5.2% 62.9 4.30sec 261279 146449 Direct 62.9 212275 424590 261279 23.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.90 62.90 0.00 0.00 1.7841 0.0000 16435130.76 16435130.76 0.00 146449.34 146449.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.38 76.92% 212275.22 199011 222144 212274.77 207573 219522 10270829 10270829 0.00
crit 14.52 23.08% 424589.61 398022 444288 424559.34 413079 442255 6164302 6164302 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186740 / 26557
Lightning Blast 186740 2.5% 42.0 6.70sec 189402 202619 Direct 42.0 153573 307172 189403 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.97 41.97 0.00 0.00 0.9348 0.0000 7949573.38 7949573.38 0.00 202619.50 202619.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.18 76.67% 153572.70 147415 164551 153602.55 148803 160308 4942143 4942143 0.00
crit 9.79 23.33% 307171.95 294831 329102 307209.28 0 329102 3007430 3007430 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
li_lvb
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0338 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.30sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.19 0.00 0.00 0.00 0.5209 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.10% 32.10% 3.1(3.1) 7.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 68.8sec 68.8sec 8.73% 8.73% 0.0(0.0) 3.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.73%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.6sec 34.94% 34.94% 1.4(1.4) 10.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.1sec 23.6sec 34.99% 34.99% 1.4(1.4) 10.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.7 28.0sec 23.6sec 33.74% 33.74% 1.7(1.7) 9.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.3 4.1sec 2.9sec 60.70% 63.29% 30.3(36.3) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.62%
  • elemental_focus_2:35.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.32% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.37%
  • icefury_2:5.89%
  • icefury_3:4.94%
  • icefury_4:3.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.3 1.4 13.0sec 12.2sec 10.31% 39.71% 1.4(1.4) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.31%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 23.0sec 17.0sec 29.99% 29.99% 4.2(4.2) 12.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.1sec 69.1sec 13.57% 13.57% 0.0(0.0) 3.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.57%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.4sec 0.0sec 39.83% 39.83% 0.0(0.0) 1.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.6sec 30.3sec 21.68% 23.97% 1.4(2.9) 0.1

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:9.28%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.54% 8.82% 0.0(0.0) 0.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.71%
  • stormkeeper_3:4.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.19% 2.2(2.2) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 79.1sec
Lava Surge: During Lava Burst 3.7 58.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6870.0014.2832.4760.0008.926
Fire Elemental0.3380.0011.2480.0940.0001.248
Lava Burst0.8950.0019.2097.2670.00028.365
Elemental Blast0.5330.0013.8848.8172.44118.723
Icefury0.9860.0018.2737.2080.04922.737

Resources

Resource Usage Type Count Total Average RPE APR
li_lvb
earth_shock Maelstrom 134.7 16156.1 120.0 979.2 2025.4
flame_shock Maelstrom 91.6 1636.0 17.9 145.8 11262.3
frost_shock Maelstrom 313.4 6268.5 20.0 163.3 5890.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 482.49 5728.04 (23.38%) 11.87 61.82 1.07%
Lava Burst Overload Maelstrom 307.64 2668.41 (10.89%) 8.67 100.37 3.62%
Lightning Bolt Maelstrom 792.53 6323.82 (25.81%) 7.98 16.45 0.26%
Lightning Bolt Overload Maelstrom 770.91 4572.37 (18.66%) 5.93 53.07 1.15%
Icefury Maelstrom 79.24 1889.74 (7.71%) 23.85 11.95 0.63%
Icefury Overload Maelstrom 50.64 901.91 (3.68%) 17.81 9.56 1.05%
Resonance Totem Maelstrom 2436.34 2413.73 (9.85%) 0.99 22.62 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.83
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.57 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data li_lvb Fight Length
Count 9428
Mean 300.01
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 35.8703
5th Percentile 245.39
95th Percentile 354.60
( 95th Percentile - 5th Percentile ) 109.20
Mean Distribution
Standard Deviation 0.3694
95.00% Confidence Intervall ( 299.29 - 300.73 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 550
0.1% Error 54916
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1099
DPS
Sample Data li_lvb Damage Per Second
Count 9428
Mean 1061006.71
Minimum 920481.79
Maximum 1228311.00
Spread ( max - min ) 307829.21
Range [ ( max - min ) / 2 * 100% ] 14.51%
Standard Deviation 42020.6222
5th Percentile 994842.60
95th Percentile 1133029.38
( 95th Percentile - 5th Percentile ) 138186.78
Mean Distribution
Standard Deviation 432.7656
95.00% Confidence Intervall ( 1060158.50 - 1061854.91 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6026
0.1 Scale Factor Error with Delta=300 15073310
0.05 Scale Factor Error with Delta=300 60293240
0.01 Scale Factor Error with Delta=300 1507330981
Priority Target DPS
Sample Data li_lvb Priority Target Damage Per Second
Count 9428
Mean 1061006.71
Minimum 920481.79
Maximum 1228311.00
Spread ( max - min ) 307829.21
Range [ ( max - min ) / 2 * 100% ] 14.51%
Standard Deviation 42020.6222
5th Percentile 994842.60
95th Percentile 1133029.38
( 95th Percentile - 5th Percentile ) 138186.78
Mean Distribution
Standard Deviation 432.7656
95.00% Confidence Intervall ( 1060158.50 - 1061854.91 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6026
0.1 Scale Factor Error with Delta=300 15073310
0.05 Scale Factor Error with Delta=300 60293240
0.01 Scale Factor Error with Delta=300 1507330981
DPS(e)
Sample Data li_lvb Damage Per Second (Effective)
Count 9428
Mean 1061006.71
Minimum 920481.79
Maximum 1228311.00
Spread ( max - min ) 307829.21
Range [ ( max - min ) / 2 * 100% ] 14.51%
Damage
Sample Data li_lvb Damage
Count 9428
Mean 293496294.17
Minimum 212795076.74
Maximum 378248503.25
Spread ( max - min ) 165453426.52
Range [ ( max - min ) / 2 * 100% ] 28.19%
DTPS
Sample Data li_lvb Damage Taken Per Second
Count 9428
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data li_lvb Healing Per Second
Count 9428
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data li_lvb Healing Per Second (Effective)
Count 9428
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data li_lvb Heal
Count 9428
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data li_lvb Healing Taken Per Second
Count 9428
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data li_lvb Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data li_lvbTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data li_lvb Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.03 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.05 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.06 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.31 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.45 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.75 elemental_blast
Keep your EB always on Cooldown.
I 12.60 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.52 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 10.00 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.67 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.77 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.91 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.19 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.31 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.06 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 19.22 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 76.00 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMLLLGMGNNRMRHFRPSSSMMRRIRSSSMHMRIMRKNNMNNOHMRMRMIRRSMHMSSIJMMSKNHMNNNSOSSMRRHIMMRRRMISMHKMMNNNNSFMRHQRRMISSSASJHMMOKGGMMGNSHMIMMSSSSMPHSSSMOSKNNMHNNSSSMSISSSSHMMSSJPSSMMOHKNNMNNSSSMHSIMS97SSMSSSOSHMIQKNNMNNRRHRMSSASISJMHOSMSMMSSIKNMNMMHNNSSMMSSIHMMMOSSSSMSHIKNMNNS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.964 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.050 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:04.868 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:05.684 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:06.500 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:07.317 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
0:08.132 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:09.219 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.037 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:10.853 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.669 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.756 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.843 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.931 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.045 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.859 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.947 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:18.702 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:19.460 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:20.217 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:20.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:21.730 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:22.486 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:23.242 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:23.997 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:24.753 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:25.509 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:26.266 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:27.024 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:27.781 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:28.535 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:29.292 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:30.049 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:31.329 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:32.288 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:33.246 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:34.525 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:35.803 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:36.763 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:37.724 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:38.976 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.775 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:40.573 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.372 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.757 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.748 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.094 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.440 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.786 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.796 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.807 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.154 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.501 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.848 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.907 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.319 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.731 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.142 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.556 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.616 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.677 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.089 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.127 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.166 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.550 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
1:08.588 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:09.970 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:11.290 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
1:12.280 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
1:13.270 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
1:14.262 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.254 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.246 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.256 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.601 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.947 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.293 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.705 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.116 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.175 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.186 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.532 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.879 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:30.200 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.518 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.508 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.500 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:34.822 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:36.206 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:37.590 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.937 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:39.948 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:41.293 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:42.304 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:43.313 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:44.324 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:45.335 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:46.680 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:47.689 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:49.099 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:50.510 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:51.922 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.678 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.088 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.498 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.909 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.970 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.381 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.794 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.206 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.206 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.617 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.675 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.087 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:07.499 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.558 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:09.617 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.030 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
2:12.089 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
2:13.149 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:14.210 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
2:15.622 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:16.660 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw
2:17.697 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:18.737 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:20.121 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:21.112 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.104 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.451 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.461 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.808 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.155 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.501 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.849 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.195 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.253 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.662 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.074 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.486 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.897 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.308 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.370 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.782 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.193 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:44.254 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:45.313 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:46.724 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:48.134 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:49.194 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:50.253 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.666 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.077 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:54.061 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:55.023 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:55.987 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:56.743 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:57.705 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:58.667 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:59.629 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:00.590 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:01.572 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:02.327 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:03.266 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:04.203 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:05.140 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:06.328 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:07.518 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:08.706 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:09.895 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:11.082 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:12.665 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:13.911 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.322 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.734 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
3:17.794 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
3:18.853 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:20.265 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
3:21.325 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:22.384 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.795 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.208 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.620 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:27.602 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:28.584 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:29.564 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:30.318 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:31.071 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:32.054 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:32.808 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:32.808 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:33.790 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:34.772 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:35.752 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:36.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:37.715 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:38.699 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:39.943 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:41.604 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
3:43.264 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:44.817 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:45.984 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
3:46.762 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:48.082 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
3:49.072 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:50.062 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:51.407 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), potion_of_prolonged_power
3:52.418 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
3:53.429 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:54.839 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:56.249 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:57.661 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:59.045 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:00.427 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:01.811 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.194 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:03.194 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.578 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.615 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:06.997 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:08.036 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:09.419 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:11.040 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:12.080 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:12.834 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:13.587 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:14.340 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:15.304 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:16.060 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:16.813 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:17.796 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:18.551 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:19.532 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
4:20.286 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
4:21.039 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
4:21.792 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
4:22.546 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
4:23.528 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
4:24.509 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), devils_due, potion_of_prolonged_power
4:25.755 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, devils_due, potion_of_prolonged_power
4:27.001 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:28.662 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:30.322 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:31.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:33.228 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.023 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.061 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.444 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.483 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:40.522 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:41.905 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.944 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:44.326 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:45.709 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:47.092 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.476 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.858 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.242 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.625 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.684 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.030 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw
4:56.022 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:57.343 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw
4:58.335 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
4:59.327 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="li_lvb"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:5:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

mb_lvs : 1057250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1057250.1 1057250.1 845.3 / 0.080% 163583.8 / 15.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mb_lvs 1057250
Earth Shock 108686 10.3% 16.5 17.49sec 1979173 2043856 Direct 16.5 1399227 3877227 1979093 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 0.9684 0.0000 32605632.28 32605632.28 0.00 2043855.84 2043855.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.62 76.60% 1399227.34 1135077 1669384 1399746.11 1229169 1531920 17656602 17656602 0.00
crit 3.86 23.40% 3877226.58 3141892 4620854 3823930.97 0 4620854 14949030 14949030 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 62978 (96356) 6.0% (9.1%) 22.1 13.75sec 1307511 986067 Direct 22.0 609154 1686575 856761 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.04 0.00 0.00 1.3260 0.0000 18884830.69 18884830.69 0.00 986067.16 986067.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.98 77.02% 609154.29 521261 680768 609245.14 556235 647269 10341958 10341958 0.00
crit 5.07 22.98% 1686574.71 1442850 1884366 1678845.65 0 1884366 8542873 8542873 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33378 3.2% 14.0 21.06sec 717123 0 Direct 13.9 511778 1417148 718844 22.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.92 0.00 0.00 0.0000 0.0000 10005950.98 10005950.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.73 77.12% 511777.99 437859 571845 511940.27 458561 558103 5493803 5493803 0.00
crit 3.18 22.88% 1417148.42 1211994 1582868 1372870.88 0 1582868 4512148 4512148 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61421 5.8% 11.2 27.74sec 1641018 1710861 Direct 11.2 92014 255156 130047 23.3%  
Periodic 236.1 50970 141073 71804 23.1% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.15 236.15 0.9592 1.2628 18415710.00 18415710.00 0.00 59602.78 1710861.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.61 76.69% 92013.67 77837 101655 92003.01 84247 98724 791856 791856 0.00
crit 2.62 23.31% 255155.90 215453 281381 241478.04 0 281381 667543 667543 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.5 76.88% 50970.20 32 55911 50972.92 47319 53138 9253494 9253494 0.00
crit 54.6 23.12% 141073.43 101 154763 141079.55 129217 147188 7702817 7702817 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123222 11.7% 38.4 7.54sec 962691 1006976 Direct 38.4 678918 1879295 962719 23.6%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.36 38.36 0.00 0.00 0.9560 0.0000 36924812.55 36924812.55 0.00 1006976.26 1006976.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.29 76.36% 678917.67 465695 770114 679302.98 636328 721016 19884310 19884310 0.00
crit 9.07 23.64% 1879294.91 1632219 2131677 1877554.68 0 2131677 17040502 17040502 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35107 (53884) 3.3% (5.1%) 9.7 32.12sec 1665939 1308803 Direct 9.7 770860 2135331 1087548 23.2%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.67 0.00 0.00 1.2730 0.0000 10517218.35 10517218.35 0.00 1308803.03 1308803.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.43 76.79% 770859.59 663371 866364 770941.24 684131 866364 5724382 5724382 0.00
crit 2.24 23.21% 2135330.63 1836210 2398095 1968270.40 0 2398095 4792836 4792836 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18777 1.8% 6.2 46.99sec 911289 0 Direct 6.2 647690 1789936 913358 23.3%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.18 6.17 0.00 0.00 0.0000 0.0000 5632102.28 5632102.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.73 76.74% 647689.88 557231 727745 645947.21 0 727745 3064761 3064761 0.00
crit 1.43 23.26% 1789936.18 1542417 2014400 1408040.08 0 2014400 2567341 2567341 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 159710 (249209) 15.1% (23.6%) 59.0 5.02sec 1265936 1084284 Direct 58.9 0 813285 813285 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.03 58.88 0.00 0.00 1.1675 0.0000 47888553.80 47888553.80 0.00 1084284.50 1084284.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.88 100.00% 813284.86 708669 925523 813371.57 778966 848772 47888554 47888554 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81414 7.7% 37.6 7.80sec 649166 0 Direct 37.5 0 651219 651219 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.60 37.49 0.00 0.00 0.0000 0.0000 24410778.88 24410778.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.49 100.00% 651218.71 567517 741178 651298.05 619179 686209 24410779 24410779 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8085 0.8% 43.7 6.13sec 55490 0 Direct 43.7 44709 91205 55491 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.69 43.69 0.00 0.00 0.0000 0.0000 2424133.45 2424133.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.56 76.81% 44709.35 42943 47934 44722.26 43103 47140 1500324 1500324 0.00
crit 10.13 23.19% 91204.98 87603 97785 91201.34 0 97785 923810 923810 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122310 (223686) 11.6% (21.2%) 97.1 3.01sec 690700 574231 Direct 97.1 237306 659495 377646 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.08 97.08 0.00 0.00 1.2028 0.0000 36660467.09 36660467.09 0.00 574230.66 574230.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.81 66.76% 237306.05 154272 604437 237621.13 195489 286560 15379864 15379864 0.00
crit 32.27 33.24% 659494.55 427024 1673082 659916.92 479522 957610 21280603 21280603 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101377 9.6% 94.2 3.77sec 322530 0 Direct 94.2 202699 563651 322520 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.22 94.22 0.00 0.00 0.0000 0.0000 30390150.42 30390150.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.94 66.80% 202699.42 129588 507727 202767.26 157506 260325 12758697 12758697 0.00
crit 31.28 33.20% 563650.62 358700 1405389 563882.83 409270 835777 17631454 17631454 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59320) 0.0% (5.6%) 3.0 120.38sec 5928824 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.61 0.00 0.0000 1.0000 0.00 0.00 0.00 306618.20 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 18986 1.8% 37.5 6.94sec 150558 0 Direct 37.4 121869 248614 151158 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.54 37.39 0.00 0.00 0.0000 0.0000 5652520.57 5652520.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.75 76.89% 121869.49 121869 121869 121869.49 121869 121869 3504151 3504151 0.00
crit 8.64 23.11% 248613.77 248614 248614 248507.57 0 248614 2148369 2148369 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40334 3.8% 98.4 2.62sec 122078 0 Direct 98.1 98655 201256 122386 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.39 98.15 0.00 0.00 0.0000 0.0000 12011753.85 12011753.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.44 76.87% 98654.92 98655 98655 98654.92 98655 98655 7442937 7442937 0.00
crit 22.70 23.13% 201256.04 201256 201256 201256.04 201256 201256 4568817 4568817 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143854 / 54979
Fire Blast 143854 5.2% 62.7 4.31sec 261492 146447 Direct 62.7 212276 424606 261489 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.66 62.66 0.00 0.00 1.7856 0.0000 16386371.07 16386371.07 0.00 146446.79 146446.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.14 76.82% 212276.49 199011 222144 212281.03 207639 219589 10219022 10219022 0.00
crit 14.52 23.18% 424605.70 398022 444288 424575.66 412258 442614 6167349 6167349 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186530 / 26488
Lightning Blast 186530 2.5% 41.9 6.72sec 189182 202340 Direct 41.9 153599 307231 189186 23.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.90 41.90 0.00 0.00 0.9350 0.0000 7927271.16 7927271.16 0.00 202339.86 202339.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.20 76.84% 153599.23 147415 164551 153633.55 148813 160941 4945478 4945478 0.00
crit 9.71 23.16% 307231.36 294831 329102 307316.54 294831 329102 2981793 2981793 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
mb_lvs
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0346 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.56sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.8212 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.14sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.21 0.00 0.00 0.00 0.5218 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.6sec 25.1sec 32.13% 32.13% 3.1(3.1) 7.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.4sec 69.4sec 8.60% 8.60% 0.0(0.0) 3.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.60%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.3sec 23.7sec 34.77% 34.77% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.1sec 23.6sec 34.94% 34.94% 1.4(1.4) 10.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.3 1.8 27.9sec 23.4sec 33.89% 33.89% 1.8(1.8) 9.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.2 4.1sec 2.9sec 60.66% 63.27% 30.2(36.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.58%
  • elemental_focus_2:35.09%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.31% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.36%
  • icefury_2:5.87%
  • icefury_3:4.95%
  • icefury_4:3.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.3 13.0sec 12.3sec 10.27% 39.61% 1.3(1.3) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.27%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 13.0 4.2 22.9sec 17.0sec 29.96% 29.96% 4.2(4.2) 12.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.8sec 69.8sec 13.38% 13.38% 0.0(0.0) 3.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.38%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.1sec 0.0sec 39.86% 39.86% 0.0(0.0) 1.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.4 1.4 36.8sec 30.5sec 21.53% 23.78% 1.4(2.9) 0.1

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:9.13%

Trigger Attempt Success

  • trigger_pct:14.93%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.53% 8.80% 0.0(0.0) 0.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.70%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.20% 2.2(2.2) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.5 12.3sec
Lava Surge: Wasted 1.4 79.5sec
Lava Surge: During Lava Burst 3.7 57.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6780.0014.6702.4480.0008.535
Fire Elemental0.3440.0011.2490.0910.0001.249
Lava Burst0.8940.0017.6617.2260.00030.037
Elemental Blast0.5310.0014.6168.8252.66718.926
Icefury0.9830.0017.6507.1850.50020.309

Resources

Resource Usage Type Count Total Average RPE APR
mb_lvs
earth_shock Maelstrom 135.2 16217.5 120.0 984.4 2010.5
flame_shock Maelstrom 92.1 1645.2 17.9 146.6 11193.3
frost_shock Maelstrom 314.8 6295.6 20.0 164.1 5865.2
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 484.40 5751.14 (23.38%) 11.87 61.68 1.06%
Lava Burst Overload Maelstrom 308.59 2678.15 (10.89%) 8.68 99.17 3.57%
Lightning Bolt Maelstrom 796.68 6356.75 (25.84%) 7.98 16.73 0.26%
Lightning Bolt Overload Maelstrom 773.29 4586.38 (18.64%) 5.93 53.33 1.15%
Icefury Maelstrom 79.56 1897.44 (7.71%) 23.85 11.90 0.62%
Icefury Overload Maelstrom 50.72 903.76 (3.67%) 17.82 9.21 1.01%
Resonance Totem Maelstrom 2449.27 2426.64 (9.86%) 0.99 22.63 0.92%
Resource RPS-Gain RPS-Loss
Maelstrom 9.99 9.81
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.56 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data mb_lvs Fight Length
Count 9364
Mean 300.00
Minimum 239.99
Maximum 360.01
Spread ( max - min ) 120.02
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 36.5466
5th Percentile 245.06
95th Percentile 354.91
( 95th Percentile - 5th Percentile ) 109.85
Mean Distribution
Standard Deviation 0.3777
95.00% Confidence Intervall ( 299.26 - 300.74 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 571
0.1% Error 57011
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1141
DPS
Sample Data mb_lvs Damage Per Second
Count 9364
Mean 1057250.15
Minimum 917375.51
Maximum 1226811.47
Spread ( max - min ) 309435.96
Range [ ( max - min ) / 2 * 100% ] 14.63%
Standard Deviation 41734.5677
5th Percentile 991861.15
95th Percentile 1129268.79
( 95th Percentile - 5th Percentile ) 137407.65
Mean Distribution
Standard Deviation 431.2859
95.00% Confidence Intervall ( 1056404.84 - 1058095.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5986
0.1 Scale Factor Error with Delta=300 14868786
0.05 Scale Factor Error with Delta=300 59475144
0.01 Scale Factor Error with Delta=300 1486878588
Priority Target DPS
Sample Data mb_lvs Priority Target Damage Per Second
Count 9364
Mean 1057250.15
Minimum 917375.51
Maximum 1226811.47
Spread ( max - min ) 309435.96
Range [ ( max - min ) / 2 * 100% ] 14.63%
Standard Deviation 41734.5677
5th Percentile 991861.15
95th Percentile 1129268.79
( 95th Percentile - 5th Percentile ) 137407.65
Mean Distribution
Standard Deviation 431.2859
95.00% Confidence Intervall ( 1056404.84 - 1058095.45 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5986
0.1 Scale Factor Error with Delta=300 14868786
0.05 Scale Factor Error with Delta=300 59475144
0.01 Scale Factor Error with Delta=300 1486878588
DPS(e)
Sample Data mb_lvs Damage Per Second (Effective)
Count 9364
Mean 1057250.15
Minimum 917375.51
Maximum 1226811.47
Spread ( max - min ) 309435.96
Range [ ( max - min ) / 2 * 100% ] 14.63%
Damage
Sample Data mb_lvs Damage
Count 9364
Mean 292424615.20
Minimum 204068880.41
Maximum 385959648.98
Spread ( max - min ) 181890768.57
Range [ ( max - min ) / 2 * 100% ] 31.10%
DTPS
Sample Data mb_lvs Damage Taken Per Second
Count 9364
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data mb_lvs Healing Per Second
Count 9364
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data mb_lvs Healing Per Second (Effective)
Count 9364
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data mb_lvs Heal
Count 9364
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data mb_lvs Healing Taken Per Second
Count 9364
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data mb_lvs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data mb_lvsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data mb_lvs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 2.04 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.03 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.26 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.46 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.60 elemental_blast
Keep your EB always on Cooldown.
I 12.49 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.48 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.92 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.61 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 60.27 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 32.60 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 7.17 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.29 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.06 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.93 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 75.65 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMLLLGMGNNSOMMSHPSSSMMSSPSMSHMMSSKGGNMNOSSHSMISSSSMRHRRJIMMKMNNNHMNOSSSMSSMHIMSSSSSMSHPKMMNNFNRNMHMQRRMIARJLLSHMMOSPKMMNNHNNSMMSSSPSHMSOSSMMSPKHNMMNNNSSMMHJLLILMMORRRSHMMPKNNSNSMNSHSSM97SSSIMSHSQOMSMMKGNNNSSHMSASIMJMSOSHSMSSSISKMMHNNNMNRRRSMHISSOSMSSSHKGGMNNM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.875 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:02.630 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.385 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.140 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.894 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.647 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.401 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.153 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.907 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.662 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.417 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.171 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.927 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.680 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:12.434 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:13.189 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:14.466 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:15.890 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:16.848 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:18.127 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:19.406 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:20.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:21.646 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.734 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.821 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.907 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.724 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.811 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.628 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.714 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.800 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.887 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.703 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.788 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.875 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.961 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
0:35.760 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
0:36.560 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
0:37.359 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:38.424 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
0:39.224 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.024 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.088 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.500 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.913 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.326 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.738 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.797 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.208 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.618 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.029 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.441 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.852 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.263 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.672 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.083 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.429 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.439 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.450 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.462 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.806 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.303 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:07.315 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:08.326 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:09.386 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:10.446 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:11.858 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:13.272 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:14.330 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.386 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.445 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.857 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.269 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.682 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.065 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.448 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.486 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.869 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.909 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.292 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.675 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:31.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:32.442 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.824 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.234 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.646 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.058 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.471 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.530 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.940 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:42.998 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:44.409 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:45.469 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:46.528 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:47.590 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:48.649 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:50.060 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:51.119 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.529 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.941 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.002 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.757 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.169 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.580 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.992 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.051 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.051 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.463 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.524 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.584 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:05.622 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:06.662 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:08.045 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:09.083 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:10.467 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:11.526 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:12.939 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:13.999 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:15.411 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:16.470 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:17.884 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
2:18.943 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
2:20.003 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:21.454 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
2:22.515 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:23.576 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.988 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.047 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.458 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.869 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.281 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.691 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.730 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.113 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.496 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.879 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.262 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.321 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.731 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.143 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.202 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.613 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.025 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.084 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.496 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
2:49.878 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
2:50.917 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:51.957 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:53.341 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:54.381 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw
2:55.420 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:56.480 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.892 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.304 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.716 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.777 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.287 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.529 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.539 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.548 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.558 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.568 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.578 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.923 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:11.678 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:12.615 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:13.552 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:14.535 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:15.515 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:16.478 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:17.231 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:18.194 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:18.948 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:19.910 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:20.666 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:21.422 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:22.384 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
3:23.139 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due
3:24.798 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due
3:26.458 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:27.680 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:29.308 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:30.936 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.255 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.574 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.894 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.885 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.885 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:37.233 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:38.580 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:39.901 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:40.893 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:42.214 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:43.175 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:44.137 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:45.057 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:45.811 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:46.565 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:47.319 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:48.236 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:48.991 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
3:49.909 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:50.845 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
3:51.599 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
3:52.353 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:53.108 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:53.863 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
3:54.799 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
3:56.458 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
3:58.118 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
3:59.780 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:01.408 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:01.408 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
4:03.037 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:04.076 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:05.113 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:06.153 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:07.566 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:08.625 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:09.685 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:10.742 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:12.154 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:13.146 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:14.468 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:15.788 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:17.108 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
4:18.427 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:19.436 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:20.783 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:22.188 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:23.535 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:24.595 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), potion_of_prolonged_power
4:26.008 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
4:27.068 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
4:28.078 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
4:29.086 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:30.405 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:31.396 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:32.717 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:34.036 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
4:35.355 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
4:36.702 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.115 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.527 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.586 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.997 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.407 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.468 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.879 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.291 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.704 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.116 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.530 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.942 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.289 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:55.298 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:56.308 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:57.655 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:58.665 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:59.678 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="mb_lvs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:5:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

tgt_eq : 1053569 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1053568.7 1053568.7 842.3 / 0.080% 161253.0 / 15.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 53.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Icefury (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
tgt_eq 1053569
Earth Shock 108800 10.3% 16.5 17.50sec 1980835 2045587 Direct 16.5 1398812 3877729 1980898 23.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.9684 0.0000 32643477.00 32643477.00 0.00 2045586.98 2045586.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.61 76.52% 1398811.55 1135077 1669384 1399355.83 1267667 1551732 17639117 17639117 0.00
crit 3.87 23.48% 3877729.25 3141892 4620854 3825056.23 0 4620854 15004360 15004360 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 63025 (96312) 6.0% (9.2%) 22.1 13.75sec 1307097 985998 Direct 22.0 609197 1686812 857371 23.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.10 22.05 0.00 0.00 1.3257 0.0000 18901844.15 18901844.15 0.00 985997.76 985997.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.97 76.97% 609196.65 521261 680768 609284.55 559406 647553 10337844 10337844 0.00
crit 5.08 23.03% 1686811.64 1442850 1884366 1679300.25 0 1884366 8564000 8564000 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 33287 3.2% 13.9 21.11sec 716180 0 Direct 13.9 511828 1415968 717735 22.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.91 0.00 0.00 0.0000 0.0000 9984932.37 9984932.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.74 77.22% 511828.00 437859 571845 511846.15 453960 552606 5498257 5498257 0.00
crit 3.17 22.78% 1415968.10 1211994 1582868 1371125.32 0 1582868 4486676 4486676 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:6.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 61473 5.8% 11.2 27.75sec 1643028 1713309 Direct 11.2 91964 255321 129876 23.2%  
Periodic 236.2 50953 141057 71856 23.2% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 236.23 236.23 0.9590 1.2624 18431781.00 18431781.00 0.00 59652.67 1713309.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.61 76.79% 91964.09 77837 101655 91953.02 81517 98398 792199 792199 0.00
crit 2.60 23.21% 255320.77 215453 281381 241229.10 0 281381 664828 664828 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.4 76.80% 50953.50 41 55911 50955.19 46965 52830 9244468 9244468 0.00
crit 54.8 23.20% 141056.68 210 154763 141060.71 128389 147957 7730286 7730286 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frost Shock 123380 11.7% 38.4 7.54sec 963885 1008350 Direct 38.4 678957 1880580 963914 23.7%  

Stats details: frost_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 0.9559 0.0000 36982231.71 36982231.71 0.00 1008349.65 1008349.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.27 76.29% 678957.22 589674 770114 679305.11 633450 732149 19872814 19872814 0.00
crit 9.10 23.71% 1880580.43 1550608 2131677 1879751.17 1632219 2131677 17109417 17109417 0.00
 
 

Action details: frost_shock

Static Values
  • id:196840
  • school:frost
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icefury.up&maelstrom>=111&!buff.ascendance.up
Spelldata
  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=1} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=5 seconds}. Maelstrom increases damage and duration up to {$s3=100}%.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Icefury 35215 (54052) 3.3% (5.1%) 9.7 32.12sec 1670969 1312423 Direct 9.7 771402 2136073 1090869 23.4%  

Stats details: icefury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.70 9.68 0.00 0.00 1.2732 0.0000 10555697.99 10555697.99 0.00 1312422.73 1312422.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.59% 771402.47 663371 866364 771487.92 663371 852484 5716359 5716359 0.00
crit 2.27 23.41% 2136072.72 1836210 2398095 1965814.01 0 2398095 4839339 4839339 0.00
 
 

Action details: icefury

Static Values
  • id:210714
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
Spelldata
  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Icefury Overload 18838 1.8% 6.2 46.74sec 912180 0 Direct 6.2 647868 1793372 914053 23.2%  

Stats details: icefury_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 6.18 0.00 0.00 0.0000 0.0000 5646160.61 5646160.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.74 76.77% 647867.81 557231 727745 646770.44 0 727745 3072464 3072464 0.00
crit 1.44 23.23% 1793371.89 1542417 2014400 1411401.61 0 2014400 2573697 2573697 0.00
 
 

Action details: icefury_overload

Static Values
  • id:219271
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage. |cFFFFFFFFGenerates {$s2=18} Maelstom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lava Burst 156198 (244516) 14.8% (23.2%) 59.1 5.03sec 1241469 1063586 Direct 58.9 0 795052 795052 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.07 58.91 0.00 0.00 1.1673 0.0000 46838579.59 46838579.59 0.00 1063586.22 1063586.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.91 100.00% 795052.27 692614 904556 795113.39 762719 831878 46838580 46838580 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 80209 7.6% 37.6 7.83sec 640241 0 Direct 37.5 0 642223 642223 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.57 37.46 0.00 0.00 0.0000 0.0000 24056240.19 24056240.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 37.46 100.00% 642223.00 559584 730817 642274.05 603547 678910 24056240 24056240 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 8109 0.8% 43.8 6.18sec 55488 0 Direct 43.8 44708 91203 55490 23.2%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.85 43.85 0.00 0.00 0.0000 0.0000 2433068.87 2433068.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.68 76.81% 44708.34 42943 47934 44718.37 42943 46705 1505838 1505838 0.00
crit 10.17 23.19% 91202.66 87603 97785 91219.92 0 97785 927231 927231 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 122355 (224072) 11.6% (21.3%) 97.1 3.01sec 691780 575302 Direct 97.1 237198 660571 377728 33.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.09 97.09 0.00 0.00 1.2025 0.0000 36672678.11 36672678.11 0.00 575301.65 575301.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.86 66.81% 237197.85 154272 604437 237488.38 196777 281066 15385102 15385102 0.00
crit 32.22 33.19% 660571.30 427024 1673082 661027.21 480230 919297 21287576 21287576 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 101717 9.7% 94.4 3.77sec 322957 0 Direct 94.4 202766 564675 322948 33.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.41 94.41 0.00 0.00 0.0000 0.0000 30490337.57 30490337.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.06 66.79% 202765.99 129588 507727 202882.28 159195 269047 12786238 12786238 0.00
crit 31.35 33.21% 564674.57 358700 1405389 565050.81 407313 872075 17704099 17704099 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (59369) 0.0% (5.6%) 3.0 120.38sec 5927795 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 57.67 0.00 0.0000 1.0000 0.00 0.00 0.00 306559.48 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19012 1.8% 37.6 6.98sec 150568 0 Direct 37.4 121869 248614 151169 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.59 37.44 0.00 0.00 0.0000 0.0000 5660047.92 5660047.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.79 76.89% 121869.49 121869 121869 121869.49 121869 121869 3508386 3508386 0.00
crit 8.65 23.11% 248613.77 248614 248614 248586.58 0 248614 2151662 2151662 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 40357 3.8% 98.5 2.62sec 122021 0 Direct 98.3 98655 201256 122322 23.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.49 98.25 0.00 0.00 0.0000 0.0000 12018317.82 12018317.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.59 76.93% 98654.92 98655 98655 98654.92 98655 98655 7457197 7457197 0.00
crit 22.66 23.07% 201256.04 201256 201256 201256.04 201256 201256 4561121 4561121 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 143940 / 55080
Fire Blast 143940 5.2% 62.8 4.31sec 261550 146531 Direct 62.8 212303 424593 261549 23.2%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.76 62.76 0.00 0.00 1.7850 0.0000 16415280.56 16415280.56 0.00 146530.99 146530.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.20 76.80% 212302.64 199011 222144 212298.33 207552 219688 10233238 10233238 0.00
crit 14.56 23.20% 424592.50 398022 444288 424588.91 411368 444288 6182043 6182043 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 186674 / 26514
Lightning Blast 186674 2.5% 41.9 6.71sec 189368 202508 Direct 41.9 153612 307232 189374 23.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.91 41.91 0.00 0.00 0.9351 0.0000 7936708.43 7936708.43 0.00 202508.38 202508.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.16 76.72% 153612.01 147415 164551 153643.83 148880 160941 4939500 4939500 0.00
crit 9.76 23.28% 307231.98 294831 329102 307225.33 0 329102 2997208 2997208 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
tgt_eq
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0330 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.4 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.8215 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 113.14sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.20 0.00 0.00 0.00 0.5217 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.0sec 69.0sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 10.6 1.4 27.2sec 23.7sec 34.85% 34.85% 1.4(1.4) 10.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:34.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 10.6 1.4 27.1sec 23.6sec 34.92% 34.92% 1.4(1.4) 10.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:34.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 10.2 1.8 28.1sec 23.5sec 33.72% 33.72% 1.8(1.8) 9.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:33.72%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 73.0 30.2 4.1sec 2.9sec 60.71% 63.29% 30.2(36.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.17

Stack Uptimes

  • elemental_focus_1:25.61%
  • elemental_focus_2:35.10%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Icefury 9.7 0.0 32.1sec 32.1sec 20.29% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_icefury
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • icefury_1:6.33%
  • icefury_2:5.86%
  • icefury_3:4.94%
  • icefury_4:3.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$s3=400}%.
  • description:Hurls frigid ice at the target, dealing {$s1=1} Frost damage and causing your next $n Frost Shocks to deal {$s3=400}% increased damage. |cFFFFFFFFGenerates {$s2=24} Maelstom.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 22.2 1.4 13.0sec 12.2sec 10.32% 39.71% 1.4(1.4) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:10.32%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.91% 29.91% 4.2(4.2) 12.6

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.3sec 69.3sec 13.47% 13.47% 0.0(0.0) 3.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.47%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 210.2sec 0.0sec 39.85% 39.85% 0.0(0.0) 1.7

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 7.5 1.4 36.7sec 30.4sec 21.69% 23.93% 1.4(2.9) 0.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.27%
  • power_of_the_maelstrom_3:9.27%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 113.1sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.4 0.0 61.6sec 61.6sec 12.52% 8.80% 0.0(0.0) 0.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.31%
  • stormkeeper_2:3.67%
  • stormkeeper_3:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 113.1sec 100.00% 98.18% 2.2(2.2) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 23.6 12.2sec
Lava Surge: Wasted 1.4 77.3sec
Lava Surge: During Lava Burst 3.7 58.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6850.0014.2982.4610.0008.401
Fire Elemental0.3340.0011.2480.0900.0001.248
Lava Burst0.9010.0018.6227.3620.00024.888
Elemental Blast0.5320.0014.2768.8243.05318.015
Icefury0.9870.0017.9197.1720.15022.410

Resources

Resource Usage Type Count Total Average RPE APR
tgt_eq
earth_shock Maelstrom 132.4 15884.5 120.0 963.9 2055.0
flame_shock Maelstrom 90.1 1610.8 17.9 143.6 11442.8
frost_shock Maelstrom 308.3 6165.9 20.0 160.7 5997.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 474.59 5634.49 (23.38%) 11.87 60.61 1.06%
Lava Burst Overload Maelstrom 301.91 2618.90 (10.87%) 8.67 98.25 3.62%
Lightning Bolt Maelstrom 780.10 6224.37 (25.83%) 7.98 16.39 0.26%
Lightning Bolt Overload Maelstrom 758.60 4498.50 (18.67%) 5.93 53.10 1.17%
Icefury Maelstrom 77.91 1858.81 (7.71%) 23.86 11.07 0.59%
Icefury Overload Maelstrom 49.73 886.00 (3.68%) 17.82 9.18 1.03%
Resonance Totem Maelstrom 2398.26 2375.93 (9.86%) 0.99 22.33 0.93%
Resource RPS-Gain RPS-Loss
Maelstrom 10.00 9.82
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.67 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data tgt_eq Fight Length
Count 9144
Mean 300.01
Minimum 239.95
Maximum 360.05
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.3691
5th Percentile 245.47
95th Percentile 354.54
( 95th Percentile - 5th Percentile ) 109.07
Mean Distribution
Standard Deviation 0.3803
95.00% Confidence Intervall ( 299.27 - 300.76 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 565
0.1% Error 56453
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1130
DPS
Sample Data tgt_eq Damage Per Second
Count 9144
Mean 1053568.68
Minimum 902509.68
Maximum 1231436.01
Spread ( max - min ) 328926.33
Range [ ( max - min ) / 2 * 100% ] 15.61%
Standard Deviation 41094.1419
5th Percentile 987867.80
95th Percentile 1122255.67
( 95th Percentile - 5th Percentile ) 134387.86
Mean Distribution
Standard Deviation 429.7460
95.00% Confidence Intervall ( 1052726.39 - 1054410.96 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5845
0.1 Scale Factor Error with Delta=300 14415958
0.05 Scale Factor Error with Delta=300 57663832
0.01 Scale Factor Error with Delta=300 1441595780
Priority Target DPS
Sample Data tgt_eq Priority Target Damage Per Second
Count 9144
Mean 1053568.68
Minimum 902509.68
Maximum 1231436.01
Spread ( max - min ) 328926.33
Range [ ( max - min ) / 2 * 100% ] 15.61%
Standard Deviation 41094.1419
5th Percentile 987867.80
95th Percentile 1122255.67
( 95th Percentile - 5th Percentile ) 134387.86
Mean Distribution
Standard Deviation 429.7460
95.00% Confidence Intervall ( 1052726.39 - 1054410.96 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5845
0.1 Scale Factor Error with Delta=300 14415958
0.05 Scale Factor Error with Delta=300 57663832
0.01 Scale Factor Error with Delta=300 1441595780
DPS(e)
Sample Data tgt_eq Damage Per Second (Effective)
Count 9144
Mean 1053568.68
Minimum 902509.68
Maximum 1231436.01
Spread ( max - min ) 328926.33
Range [ ( max - min ) / 2 * 100% ] 15.61%
Damage
Sample Data tgt_eq Damage
Count 9144
Mean 291315394.93
Minimum 203627709.03
Maximum 377569779.68
Spread ( max - min ) 173942070.65
Range [ ( max - min ) / 2 * 100% ] 29.85%
DTPS
Sample Data tgt_eq Damage Taken Per Second
Count 9144
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data tgt_eq Healing Per Second
Count 9144
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data tgt_eq Healing Per Second (Effective)
Count 9144
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data tgt_eq Heal
Count 9144
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data tgt_eq Healing Taken Per Second
Count 9144
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data tgt_eq Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data tgt_eqTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data tgt_eq Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.19 totem_mastery,if=buff.resonance_totem.remains<2
9 1.99 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 2.97 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_if
# count action,conditions
F 4.18 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
G 6.33 frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
H 22.07 elemental_blast
Keep your EB always on Cooldown.
I 12.20 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.38 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon spawning add waves.
K 9.69 icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
L 4.55 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
M 58.88 lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
N 31.82 frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
O 6.98 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,moving=1,if=buff.icefury.up
P 4.19 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Q 2.01 totem_mastery,if=buff.resonance_totem.remains<10
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up
R 18.58 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
S 73.74 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AFHKMMNNNNSSSSSMOHSSMISMMRRRSPSHMMSSKGNNMMNOSHSMSISSSMSHSSJMPSSKMLGHMMGNFMNRMPRHMRRRSMIMSKHNMNNNFSSMQSHSSMPRAJLLSMHOKNNMMGGMRIHMRRSSSMIMHSSSSMKGNNNOSSHMMSSSIMSSHJSSSMRIRRSSKNMFHNNNMRRRPSMHMMSSI97MMOQKHNMMNNNSSSMSHIMSASSJMSSSISSHMKFNNNRMNRRSSHMMISSMSMSHPSSMSFKNNNHMNSSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.958 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.990 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.754 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.517 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.280 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.059 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.838 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.617 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.396 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.467 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.556 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.374 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.461 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:17.477 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:18.494 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:19.257 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:20.021 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.038 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.054 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.833 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.872 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.908 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.946 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.984 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.801 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.887 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.973 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.060 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.876 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.963 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.047 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.133 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, potion_of_prolonged_power
0:35.949 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, potion_of_prolonged_power
0:36.768 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, potion_of_prolonged_power
0:37.584 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.670 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.487 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, potion_of_prolonged_power
0:40.302 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.100 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.484 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.866 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.248 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.632 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.017 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.057 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.441 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.824 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.208 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.618 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.029 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.439 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.852 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.264 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.303 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.687 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.725 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.764 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.802 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.185 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:08.244 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:09.304 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
1:10.365 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:11.776 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:13.187 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:14.247 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
1:15.308 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
1:16.366 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:17.424 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:18.835 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
1:19.895 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.307 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.364 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.423 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.834 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.246 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.657 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.004 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.349 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.695 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.042 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.389 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.399 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.409 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.756 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:39.166 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:40.579 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall
1:41.590 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:42.936 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall
1:43.947 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall
1:44.957 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
1:45.969 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:46.979 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:48.324 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:49.672 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.018 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:51.774 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:53.184 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:54.595 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:55.978 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:57.362 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:58.744 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:59.783 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:01.167 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.167 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:02.358 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:03.418 single_if L lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:04.478 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:05.538 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:06.950 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:08.360 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:09.420 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:10.833 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, mark_of_the_claw
2:11.873 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, mark_of_the_claw
2:12.911 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:13.950 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:15.332 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, mark_of_the_claw
2:16.370 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall
2:17.430 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.489 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.900 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.959 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.372 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.784 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.197 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.607 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.019 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.431 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.843 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.882 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.919 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.304 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.749 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:36.713 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:37.677 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:38.661 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.645 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:40.627 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:41.809 single_if G frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, nefarious_pact
2:42.564 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, nefarious_pact
2:43.320 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, nefarious_pact
2:44.073 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, concordance_of_the_legionfall, nefarious_pact
2:44.829 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:45.584 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:46.567 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:47.547 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:49.406 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:50.653 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:52.315 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:53.976 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:55.638 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.049 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.109 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.519 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.930 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.913 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:02.895 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:03.649 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:04.404 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:05.158 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:05.913 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:06.849 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:07.782 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:08.536 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:09.473 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:10.410 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:11.348 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:12.267 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:13.185 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:14.350 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:15.979 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:17.200 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due
3:18.860 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), concordance_of_the_legionfall, devils_due
3:20.049 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), concordance_of_the_legionfall, devils_due
3:21.237 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
3:22.247 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.596 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.915 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.234 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.555 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.546 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.866 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.904 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.288 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:33.610 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:34.602 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.924 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.270 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.280 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.291 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.291 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:40.302 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
3:41.649 single_if O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:42.657 single_if Q totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:43.411 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
3:44.796 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
3:46.180 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), mark_of_the_claw, potion_of_prolonged_power
3:47.172 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:48.164 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:49.487 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), mark_of_the_claw, potion_of_prolonged_power
3:50.480 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), mark_of_the_claw, potion_of_prolonged_power
3:51.472 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, mark_of_the_claw, potion_of_prolonged_power
3:52.465 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:53.811 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
3:55.158 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:56.093 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:57.030 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:58.012 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:59.157 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
3:59.911 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:00.665 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:01.583 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:01.583 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:02.501 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:03.420 single_if J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:04.382 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:05.302 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:06.057 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:06.813 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:07.567 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:08.758 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:10.341 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:12.002 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:13.662 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:15.244 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
4:16.181 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
4:16.936 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4), nefarious_pact, potion_of_prolonged_power
4:17.690 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3), nefarious_pact, potion_of_prolonged_power
4:18.444 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2), nefarious_pact, potion_of_prolonged_power
4:19.197 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:20.116 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:21.034 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:21.788 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:22.706 single_if R lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:23.623 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:24.540 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
4:25.504 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:26.641 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
4:27.394 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:28.977 single_if I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:30.165 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:31.749 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
4:33.334 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:34.523 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
4:36.108 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:37.453 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:38.866 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
4:40.278 single_if P earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.289 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.635 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.981 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.328 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.676 single_if F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.686 single_if K icefury Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.032 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(4)
4:50.044 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(3)
4:51.053 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury(2)
4:52.114 single_if H elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:53.685 single_if M lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:55.031 single_if N frost_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, icefury
4:56.042 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.389 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.733 single_if S lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81670 81670 44143
Intellect 58714 56483 46468 (20870)
Spirit 0 0 0
Health 4900200 4900200 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 58714 56483 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 934.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="tgt_eq"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112333
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:5:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=whispers_in_the_dark,id=140809,ilevel=910
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=933.63
# gear_stamina=44143
# gear_intellect=46468
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Simulation & Raid Information

Iterations: 9204
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 389544595
Max Event Queue: 53
Sim Seconds: 2761231
CPU Seconds: 234.5469
Physical Seconds: 30.6783
Speed Up: 11773

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
1ilevel 1ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
1ilevel 1ilevel earth_shock 8042 32792181 109306 3.30 1405476 3888955 16.5 16.5 23.5% 0.0% 0.0% 0.0% 17.51sec 32792181 300.00sec
1ilevel 1ilevel elemental_blast 117014 18995192 63316 4.41 611434 1692239 22.1 22.0 23.2% 0.0% 0.0% 0.0% 13.76sec 18995192 300.00sec
1ilevel 1ilevel elemental_blast_overload 120588 10035521 33451 2.78 513642 1421265 13.9 13.9 22.8% 0.0% 0.0% 0.0% 21.23sec 10035521 300.00sec
1ilevel 1ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
1ilevel 1ilevel flame_shock 188389 1461058 4870 2.24 92322 256048 11.2 11.2 23.1% 0.0% 0.0% 0.0% 27.77sec 18487778 300.00sec
1ilevel 1ilevel flame_shock ticks -188389 17026719 56756 47.27 51141 141534 11.2 236.3 23.1% 0.0% 0.0% 0.0% 27.77sec 18487778 300.00sec
1ilevel 1ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
1ilevel 1ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
1ilevel 1ilevel frost_shock 196840 36996185 123319 7.67 681260 1887082 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.54sec 36996185 300.00sec
1ilevel 1ilevel icefury 210714 10588773 35295 1.93 774211 2140441 9.7 9.7 23.6% 0.0% 0.0% 0.0% 32.13sec 10588773 300.00sec
1ilevel 1ilevel icefury_overload 219271 5662630 18875 1.23 649870 1800272 6.2 6.2 23.5% 0.0% 0.0% 0.0% 47.37sec 5662630 300.00sec
1ilevel 1ilevel lava_burst 51505 46975471 156583 11.78 0 797781 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 46975471 300.00sec
1ilevel 1ilevel lava_burst_overload 77451 24133144 80443 7.49 0 644508 37.6 37.4 100.0% 0.0% 0.0% 0.0% 7.86sec 24133144 300.00sec
1ilevel 1ilevel volcanic_inferno 205533 2449649 8165 8.79 44872 91543 44.0 44.0 23.2% 0.0% 0.0% 0.0% 6.17sec 2449649 300.00sec
1ilevel 1ilevel lightning_bolt 188196 36859275 122862 19.44 238012 662814 97.2 97.2 33.2% 0.0% 0.0% 0.0% 3.01sec 36859275 300.00sec
1ilevel 1ilevel lightning_bolt_overload 45284 30629920 102098 18.92 203366 566046 94.6 94.6 33.2% 0.0% 0.0% 0.0% 3.76sec 30629920 300.00sec
1ilevel 1ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
1ilevel 1ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.00sec
1ilevel 1ilevel spectral_blast 246442 5637328 18791 7.46 121869 248614 37.4 37.3 23.1% 0.0% 0.0% 0.0% 6.99sec 5637328 300.00sec
1ilevel 1ilevel spectral_bolt 242571 12022001 40073 19.63 98655 201256 98.4 98.1 23.2% 0.0% 0.0% 0.0% 2.61sec 12022001 300.00sec
1ilevel 1ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.57sec 0 300.00sec
1ilevel 1ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.23sec 0 300.00sec
1ilevel 1ilevel_primal_fire_elemental fire_blast 57984 16453557 144489 33.02 213051 426110 62.7 62.7 23.2% 0.0% 0.0% 0.0% 4.31sec 16453557 113.87sec
1ilevel 1ilevel_greater_lightning_elemental lightning_blast 191726 7961208 187077 59.12 154154 308308 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.70sec 7961208 42.56sec
2ilevel 2ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
2ilevel 2ilevel earth_shock 8042 32916069 109721 3.30 1410314 3909104 16.5 16.5 23.4% 0.0% 0.0% 0.0% 17.52sec 32916069 300.00sec
2ilevel 2ilevel elemental_blast 117014 19045584 63486 4.41 613725 1697935 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.75sec 19045584 300.00sec
2ilevel 2ilevel elemental_blast_overload 120588 10094384 33648 2.78 515558 1427181 14.0 13.9 23.0% 0.0% 0.0% 0.0% 21.27sec 10094384 300.00sec
2ilevel 2ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
2ilevel 2ilevel flame_shock 188389 1472038 4907 2.24 92680 257073 11.2 11.2 23.4% 0.0% 0.0% 0.0% 27.78sec 18566305 300.00sec
2ilevel 2ilevel flame_shock ticks -188389 17094267 56981 47.25 51344 142101 11.2 236.3 23.1% 0.0% 0.0% 0.0% 27.78sec 18566305 300.00sec
2ilevel 2ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
2ilevel 2ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
2ilevel 2ilevel frost_shock 196840 37100250 123668 7.67 683581 1893876 38.3 38.3 23.5% 0.0% 0.0% 0.0% 7.53sec 37100250 300.00sec
2ilevel 2ilevel icefury 210714 10627567 35425 1.93 776791 2154514 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.12sec 10627567 300.00sec
2ilevel 2ilevel icefury_overload 219271 5694243 18981 1.23 652958 1806980 6.2 6.2 23.6% 0.0% 0.0% 0.0% 46.51sec 5694243 300.00sec
2ilevel 2ilevel lava_burst 51505 47289126 157631 11.81 0 800750 59.2 59.1 100.0% 0.0% 0.0% 0.0% 5.02sec 47289126 300.00sec
2ilevel 2ilevel lava_burst_overload 77451 24316419 81055 7.52 0 646831 37.7 37.6 100.0% 0.0% 0.0% 0.0% 7.82sec 24316419 300.00sec
2ilevel 2ilevel volcanic_inferno 205533 2459437 8198 8.80 45037 91877 44.0 44.0 23.2% 0.0% 0.0% 0.0% 6.21sec 2459437 300.00sec
2ilevel 2ilevel lightning_bolt 188196 36894390 122982 19.40 239054 665096 97.0 97.0 33.2% 0.0% 0.0% 0.0% 3.01sec 36894390 300.00sec
2ilevel 2ilevel lightning_bolt_overload 45284 30681535 102272 18.88 204457 567336 94.4 94.4 33.2% 0.0% 0.0% 0.0% 3.78sec 30681535 300.00sec
2ilevel 2ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
2ilevel 2ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.00sec
2ilevel 2ilevel spectral_blast 246442 5665200 18884 7.49 121869 248614 37.6 37.4 23.2% 0.0% 0.0% 0.0% 6.97sec 5665200 300.00sec
2ilevel 2ilevel spectral_bolt 242571 12030082 40101 19.66 98655 201256 98.6 98.3 23.1% 0.0% 0.0% 0.0% 2.62sec 12030082 300.00sec
2ilevel 2ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.57sec 0 300.00sec
2ilevel 2ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.08sec 0 300.00sec
2ilevel 2ilevel_primal_fire_elemental fire_blast 57984 16555298 144887 33.00 213796 427574 62.8 62.8 23.2% 0.0% 0.0% 0.0% 4.31sec 16555298 114.26sec
2ilevel 2ilevel_greater_lightning_elemental lightning_blast 191726 7991048 187868 59.14 154711 309550 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.73sec 7991048 42.54sec
3ilevel 3ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel earth_shock 8042 32970826 109904 3.30 1415538 3918365 16.5 16.5 23.4% 0.0% 0.0% 0.0% 17.51sec 32970826 300.00sec
3ilevel 3ilevel elemental_blast 117014 19131284 63771 4.41 616105 1705613 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.76sec 19131284 300.00sec
3ilevel 3ilevel elemental_blast_overload 120588 10153175 33844 2.79 517505 1432990 14.0 14.0 22.9% 0.0% 0.0% 0.0% 20.94sec 10153175 300.00sec
3ilevel 3ilevel fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel flame_shock 188389 1471678 4906 2.24 93041 257890 11.2 11.2 23.1% 0.0% 0.0% 0.0% 27.75sec 18636520 300.00sec
3ilevel 3ilevel flame_shock ticks -188389 17164842 57216 47.23 51531 142627 11.2 236.2 23.2% 0.0% 0.0% 0.0% 27.75sec 18636520 300.00sec
3ilevel 3ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel frost_shock 196840 37379275 124599 7.67 686641 1900554 38.4 38.4 23.7% 0.0% 0.0% 0.0% 7.54sec 37379275 300.00sec
3ilevel 3ilevel icefury 210714 10677274 35591 1.94 780024 2158637 9.7 9.7 23.5% 0.0% 0.0% 0.0% 32.12sec 10677274 300.00sec
3ilevel 3ilevel icefury_overload 219271 5727096 19090 1.23 655209 1813658 6.2 6.2 23.6% 0.0% 0.0% 0.0% 47.29sec 5727096 300.00sec
3ilevel 3ilevel lava_burst 51505 47423098 158078 11.80 0 803843 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.03sec 47423098 300.00sec
3ilevel 3ilevel lava_burst_overload 77451 24393465 81312 7.51 0 649255 37.7 37.6 100.0% 0.0% 0.0% 0.0% 7.83sec 24393465 300.00sec
3ilevel 3ilevel volcanic_inferno 205533 2469996 8233 8.81 45206 92231 44.1 44.1 23.1% 0.0% 0.0% 0.0% 6.15sec 2469996 300.00sec
3ilevel 3ilevel lightning_bolt 188196 37051849 123507 19.40 240091 666891 97.0 97.0 33.3% 0.0% 0.0% 0.0% 3.01sec 37051849 300.00sec
3ilevel 3ilevel lightning_bolt_overload 45284 30809242 102698 18.87 204920 570566 94.3 94.3 33.3% 0.0% 0.0% 0.0% 3.77sec 30809242 300.00sec
3ilevel 3ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
3ilevel 3ilevel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.00sec
3ilevel 3ilevel spectral_blast 246442 5660629 18869 7.48 121869 248614 37.6 37.4 23.2% 0.0% 0.0% 0.0% 6.98sec 5660629 300.00sec
3ilevel 3ilevel spectral_bolt 242571 12003040 40010 19.61 98655 201256 98.3 98.0 23.2% 0.0% 0.0% 0.0% 2.62sec 12003040 300.00sec
3ilevel 3ilevel stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.60sec 0 300.00sec
3ilevel 3ilevel totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.15sec 0 300.00sec
3ilevel 3ilevel_primal_fire_elemental fire_blast 57984 16573090 145379 32.98 214633 429276 62.7 62.7 23.2% 0.0% 0.0% 0.0% 4.31sec 16573090 114.00sec
3ilevel 3ilevel_greater_lightning_elemental lightning_blast 191726 8015490 188455 59.09 155322 310610 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.72sec 8015490 42.53sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
baseline baseline earth_shock 8042 32667467 108888 3.30 1399357 3879671 16.5 16.5 23.4% 0.0% 0.0% 0.0% 17.48sec 32667467 300.01sec
baseline baseline elemental_blast 117014 18907714 63023 4.41 609269 1686881 22.1 22.0 23.1% 0.0% 0.0% 0.0% 13.75sec 18907714 300.01sec
baseline baseline elemental_blast_overload 120588 10034894 33448 2.79 511894 1416484 14.0 14.0 22.9% 0.0% 0.0% 0.0% 20.95sec 10034894 300.01sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
baseline baseline flame_shock 188389 1457232 4857 2.25 91995 255091 11.2 11.2 23.2% 0.0% 0.0% 0.0% 27.75sec 18425978 300.01sec
baseline baseline flame_shock ticks -188389 16968746 56562 47.26 50962 141043 11.2 236.3 23.1% 0.0% 0.0% 0.0% 27.75sec 18425978 300.01sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
baseline baseline frost_shock 196840 36850279 122830 7.68 678732 1879512 38.4 38.4 23.4% 0.0% 0.0% 0.0% 7.54sec 36850279 300.01sec
baseline baseline icefury 210714 10556385 35187 1.94 770636 2137675 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.12sec 10556385 300.01sec
baseline baseline icefury_overload 219271 5657966 18859 1.24 647357 1793725 6.2 6.2 23.4% 0.0% 0.0% 0.0% 47.22sec 5657966 300.01sec
baseline baseline lava_burst 51505 46882737 156270 11.79 0 794941 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.00sec 46882737 300.01sec
baseline baseline lava_burst_overload 77451 24081279 80268 7.50 0 642099 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.83sec 24081279 300.01sec
baseline baseline volcanic_inferno 205533 2433871 8113 8.77 44711 91212 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.21sec 2433871 300.01sec
baseline baseline lightning_bolt 188196 36658333 122190 19.42 237296 660300 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.01sec 36658333 300.01sec
baseline baseline lightning_bolt_overload 45284 30478028 101590 18.89 202781 563055 94.4 94.4 33.3% 0.0% 0.0% 0.0% 3.77sec 30478028 300.01sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
baseline baseline spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.01sec
baseline baseline spectral_blast 246442 5658541 18861 7.49 121869 248614 37.6 37.4 23.1% 0.0% 0.0% 0.0% 6.98sec 5658541 300.01sec
baseline baseline spectral_bolt 242571 12029090 40096 19.65 98655 201256 98.5 98.3 23.2% 0.0% 0.0% 0.0% 2.62sec 12029090 300.01sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.57sec 0 300.01sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.08sec 0 300.01sec
baseline baseline_primal_fire_elemental fire_blast 57984 16407456 143838 33.01 212313 424667 62.8 62.8 23.1% 0.0% 0.0% 0.0% 4.30sec 16407456 114.07sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 7939018 186381 59.15 153590 307254 42.0 42.0 23.1% 0.0% 0.0% 0.0% 6.71sec 7939018 42.60sec
ctt_nature ctt_nature augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature earth_shock 8042 32908566 109696 3.30 1412863 3911372 16.5 16.5 23.3% 0.0% 0.0% 0.0% 17.47sec 32908566 300.00sec
ctt_nature ctt_nature elemental_blast 117014 19076719 63589 4.41 614941 1702863 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.75sec 19076719 300.00sec
ctt_nature ctt_nature elemental_blast_overload 120588 10112402 33708 2.79 516762 1429532 14.0 13.9 22.9% 0.0% 0.0% 0.0% 20.97sec 10112402 300.00sec
ctt_nature ctt_nature fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature flame_shock 188389 1455665 4852 2.24 91999 255330 11.2 11.2 23.1% 0.0% 0.0% 0.0% 27.75sec 18426972 300.00sec
ctt_nature ctt_nature flame_shock ticks -188389 16971306 56571 47.24 50963 141046 11.2 236.2 23.2% 0.0% 0.0% 0.0% 27.75sec 18426972 300.00sec
ctt_nature ctt_nature flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature frost_shock 196840 36884932 122950 7.67 678791 1880939 38.4 38.4 23.5% 0.0% 0.0% 0.0% 7.54sec 36884932 300.00sec
ctt_nature ctt_nature icefury 210714 10511887 35040 1.93 771071 2135158 9.7 9.7 23.2% 0.0% 0.0% 0.0% 32.14sec 10511887 300.00sec
ctt_nature ctt_nature icefury_overload 219271 5656037 18854 1.24 647846 1790664 6.2 6.2 23.3% 0.0% 0.0% 0.0% 46.38sec 5656037 300.00sec
ctt_nature ctt_nature lava_burst 51505 46908991 156364 11.80 0 794865 59.2 59.0 100.0% 0.0% 0.0% 0.0% 5.02sec 46908991 300.00sec
ctt_nature ctt_nature lava_burst_overload 77451 24141237 80471 7.52 0 642189 37.7 37.6 100.0% 0.0% 0.0% 0.0% 7.80sec 24141237 300.00sec
ctt_nature ctt_nature volcanic_inferno 205533 2430765 8103 8.76 44708 91217 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.16sec 2430765 300.00sec
ctt_nature ctt_nature lightning_bolt 188196 36976202 123255 19.40 239643 666106 97.0 97.0 33.2% 0.0% 0.0% 0.0% 3.01sec 36976202 300.00sec
ctt_nature ctt_nature lightning_bolt_overload 45284 30704695 102350 18.87 204607 568961 94.4 94.4 33.2% 0.0% 0.0% 0.0% 3.77sec 30704695 300.00sec
ctt_nature ctt_nature potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ctt_nature ctt_nature spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.39sec 0 300.00sec
ctt_nature ctt_nature spectral_blast 246442 5661071 18870 7.48 121869 248614 37.6 37.4 23.2% 0.0% 0.0% 0.0% 7.00sec 5661071 300.00sec
ctt_nature ctt_nature spectral_bolt 242571 12022087 40074 19.65 98655 201256 98.5 98.3 23.1% 0.0% 0.0% 0.0% 2.62sec 12022087 300.00sec
ctt_nature ctt_nature stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.56sec 0 300.00sec
ctt_nature ctt_nature totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.05sec 0 300.00sec
ctt_nature ctt_nature_primal_fire_elemental fire_blast 57984 16403187 143776 32.98 212291 424640 62.7 62.7 23.2% 0.0% 0.0% 0.0% 4.30sec 16403187 114.09sec
ctt_nature ctt_nature_greater_lightning_elemental lightning_blast 191726 7929634 186468 59.15 153560 307129 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.69sec 7929634 42.53sec
ea_es ea_es augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es earth_shock 8042 33771483 112567 3.30 1446590 4010758 16.5 16.5 23.5% 0.0% 0.0% 0.0% 17.52sec 33771483 300.01sec
ea_es ea_es elemental_blast 117014 18898933 62994 4.41 609262 1686252 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.76sec 18898933 300.01sec
ea_es ea_es elemental_blast_overload 120588 10002971 33342 2.78 511692 1416450 13.9 13.9 22.9% 0.0% 0.0% 0.0% 21.20sec 10002971 300.01sec
ea_es ea_es fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es flame_shock 188389 1457164 4857 2.24 92011 255100 11.2 11.2 23.2% 0.0% 0.0% 0.0% 27.78sec 18437101 300.01sec
ea_es ea_es flame_shock ticks -188389 16979937 56600 47.26 50966 141077 11.2 236.3 23.2% 0.0% 0.0% 0.0% 27.78sec 18437101 300.01sec
ea_es ea_es flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es frost_shock 196840 36921607 123067 7.67 678894 1880354 38.4 38.4 23.6% 0.0% 0.0% 0.0% 7.54sec 36921607 300.01sec
ea_es ea_es icefury 210714 10529761 35098 1.93 771280 2134482 9.7 9.7 23.3% 0.0% 0.0% 0.0% 32.13sec 10529761 300.01sec
ea_es ea_es icefury_overload 219271 5622683 18742 1.23 647794 1794026 6.2 6.2 23.0% 0.0% 0.0% 0.0% 46.97sec 5622683 300.01sec
ea_es ea_es lava_burst 51505 46823789 156074 11.78 0 794921 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 46823789 300.01sec
ea_es ea_es lava_burst_overload 77451 24053141 80174 7.49 0 642170 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.88sec 24053141 300.01sec
ea_es ea_es volcanic_inferno 205533 2433141 8110 8.77 44716 91205 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.21sec 2433141 300.01sec
ea_es ea_es lightning_bolt 188196 36759866 122528 19.43 237153 661214 97.1 97.1 33.3% 0.0% 0.0% 0.0% 3.01sec 36759866 300.01sec
ea_es ea_es lightning_bolt_overload 45284 30498317 101657 18.90 202737 564268 94.5 94.5 33.2% 0.0% 0.0% 0.0% 3.77sec 30498317 300.01sec
ea_es ea_es potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 300.01sec
ea_es ea_es spectral_blast 246442 5658502 18861 7.48 121869 248614 37.6 37.4 23.2% 0.0% 0.0% 0.0% 7.00sec 5658502 300.01sec
ea_es ea_es spectral_bolt 242571 12030945 40102 19.67 98655 201256 98.6 98.3 23.1% 0.0% 0.0% 0.0% 2.62sec 12030945 300.01sec
ea_es ea_es stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
ea_es ea_es totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.14sec 0 300.01sec
ea_es ea_es_primal_fire_elemental fire_blast 57984 16413389 143815 32.99 212307 424544 62.8 62.8 23.2% 0.0% 0.0% 0.0% 4.31sec 16413389 114.13sec
ea_es ea_es_greater_lightning_elemental lightning_blast 191726 7953887 186754 59.22 153567 307252 42.0 42.0 23.2% 0.0% 0.0% 0.0% 6.71sec 7953887 42.59sec
ede_crit ede_crit augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit earth_shock 8042 32968402 109891 3.30 1399609 3947639 16.5 16.5 23.6% 0.0% 0.0% 0.0% 17.52sec 32968402 300.01sec
ede_crit ede_crit elemental_blast 117014 19104156 63678 4.41 609235 1718577 22.1 22.0 23.2% 0.0% 0.0% 0.0% 13.75sec 19104156 300.01sec
ede_crit ede_crit elemental_blast_overload 120588 10078180 33593 2.78 511677 1442885 13.9 13.9 22.9% 0.0% 0.0% 0.0% 21.15sec 10078180 300.01sec
ede_crit ede_crit fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit flame_shock 188389 1468079 4893 2.24 91995 259729 11.2 11.2 23.2% 0.0% 0.0% 0.0% 27.76sec 18578891 300.01sec
ede_crit ede_crit flame_shock ticks -188389 17110812 57036 47.25 50958 143691 11.2 236.3 23.1% 0.0% 0.0% 0.0% 27.76sec 18578891 300.01sec
ede_crit ede_crit flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit frost_shock 196840 37254308 124177 7.67 678719 1915626 38.4 38.4 23.6% 0.0% 0.0% 0.0% 7.53sec 37254308 300.01sec
ede_crit ede_crit icefury 210714 10646079 35486 1.94 771295 2176136 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.11sec 10646079 300.01sec
ede_crit ede_crit icefury_overload 219271 5684831 18949 1.23 647851 1825562 6.2 6.2 23.4% 0.0% 0.0% 0.0% 47.01sec 5684831 300.01sec
ede_crit ede_crit lava_burst 51505 47758175 159188 11.78 0 810599 59.1 58.9 100.0% 0.0% 0.0% 0.0% 5.04sec 47758175 300.01sec
ede_crit ede_crit lava_burst_overload 77451 24469023 81561 7.49 0 653462 37.6 37.4 100.0% 0.0% 0.0% 0.0% 7.86sec 24469023 300.01sec
ede_crit ede_crit volcanic_inferno 205533 2424773 8082 8.75 44707 91207 43.7 43.7 23.1% 0.0% 0.0% 0.0% 6.13sec 2424773 300.01sec
ede_crit ede_crit lightning_bolt 188196 37056742 123518 19.42 237183 672206 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.00sec 37056742 300.01sec
ede_crit ede_crit lightning_bolt_overload 45284 30802807 102673 18.88 202721 574023 94.4 94.4 33.3% 0.0% 0.0% 0.0% 3.76sec 30802807 300.01sec
ede_crit ede_crit potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ede_crit ede_crit spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.01sec
ede_crit ede_crit spectral_blast 246442 5649405 18831 7.47 121869 248614 37.5 37.4 23.1% 0.0% 0.0% 0.0% 6.98sec 5649405 300.01sec
ede_crit ede_crit spectral_bolt 242571 12034146 40112 19.66 98655 201256 98.5 98.3 23.2% 0.0% 0.0% 0.0% 2.62sec 12034146 300.01sec
ede_crit ede_crit stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
ede_crit ede_crit totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.21sec 0 300.01sec
ede_crit ede_crit_primal_fire_elemental fire_blast 57984 16414618 143679 32.98 212287 424645 62.8 62.8 23.1% 0.0% 0.0% 0.0% 4.31sec 16414618 114.25sec
ede_crit ede_crit_greater_lightning_elemental lightning_blast 191726 7923435 186468 59.11 153583 307231 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.73sec 7923435 42.49sec
edi_cl edi_cl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
edi_cl edi_cl earth_shock 8042 32548490 108493 3.30 1399699 3871629 16.5 16.5 23.2% 0.0% 0.0% 0.0% 17.52sec 32548490 300.00sec
edi_cl edi_cl elemental_blast 117014 18840801 62802 4.41 609097 1686287 22.1 22.0 22.8% 0.0% 0.0% 0.0% 13.75sec 18840801 300.00sec
edi_cl edi_cl elemental_blast_overload 120588 10003927 33346 2.79 511647 1416072 14.0 13.9 22.9% 0.0% 0.0% 0.0% 21.17sec 10003927 300.00sec
edi_cl edi_cl fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
edi_cl edi_cl flame_shock 188389 1452203 4841 2.24 92026 254997 11.2 11.2 23.0% 0.0% 0.0% 0.0% 27.76sec 18409203 300.00sec
edi_cl edi_cl flame_shock ticks -188389 16957000 56523 47.25 50967 141082 11.2 236.3 23.1% 0.0% 0.0% 0.0% 27.76sec 18409203 300.00sec
edi_cl edi_cl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
edi_cl edi_cl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
edi_cl edi_cl frost_shock 196840 36894376 122980 7.67 678695 1879817 38.4 38.4 23.6% 0.0% 0.0% 0.0% 7.54sec 36894376 300.00sec
edi_cl edi_cl icefury 210714 10540137 35133 1.94 771081 2134355 9.7 9.7 23.3% 0.0% 0.0% 0.0% 32.13sec 10540137 300.00sec
edi_cl edi_cl icefury_overload 219271 5648885 18829 1.24 647933 1791598 6.2 6.2 23.1% 0.0% 0.0% 0.0% 47.42sec 5648885 300.00sec
edi_cl edi_cl lava_burst 51505 46915911 156384 11.81 0 794834 59.2 59.0 100.0% 0.0% 0.0% 0.0% 5.01sec 46915911 300.00sec
edi_cl edi_cl lava_burst_overload 77451 24112721 80375 7.51 0 642018 37.7 37.6 100.0% 0.0% 0.0% 0.0% 7.85sec 24112721 300.00sec
edi_cl edi_cl volcanic_inferno 205533 2443334 8144 8.81 44706 91199 44.0 44.0 23.2% 0.0% 0.0% 0.0% 6.18sec 2443334 300.00sec
edi_cl edi_cl lightning_bolt 188196 36621198 122069 19.41 237308 659776 97.1 97.1 33.1% 0.0% 0.0% 0.0% 3.01sec 36621198 300.00sec
edi_cl edi_cl lightning_bolt_overload 45284 30410650 101367 18.85 202913 564216 94.2 94.2 33.2% 0.0% 0.0% 0.0% 3.77sec 30410650 300.00sec
edi_cl edi_cl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
edi_cl edi_cl spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.00sec
edi_cl edi_cl spectral_blast 246442 5670435 18901 7.50 121869 248614 37.6 37.5 23.1% 0.0% 0.0% 0.0% 6.93sec 5670435 300.00sec
edi_cl edi_cl spectral_bolt 242571 12036632 40122 19.67 98655 201256 98.6 98.4 23.1% 0.0% 0.0% 0.0% 2.62sec 12036632 300.00sec
edi_cl edi_cl stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.00sec
edi_cl edi_cl totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.06sec 0 300.00sec
edi_cl edi_cl_primal_fire_elemental fire_blast 57984 16437315 143852 33.01 212270 424583 62.9 62.9 23.2% 0.0% 0.0% 0.0% 4.30sec 16437315 114.27sec
edi_cl edi_cl_greater_lightning_elemental lightning_blast 191726 7943302 186599 59.10 153581 307215 41.9 41.9 23.3% 0.0% 0.0% 0.0% 6.73sec 7943302 42.57sec
fs_fs fs_fs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
fs_fs fs_fs earth_shock 8042 32637812 108798 3.30 1399671 3876134 16.5 16.5 23.4% 0.0% 0.0% 0.0% 17.51sec 32637812 299.99sec
fs_fs fs_fs elemental_blast 117014 18863861 62883 4.41 609397 1686467 22.1 22.0 22.9% 0.0% 0.0% 0.0% 13.76sec 18863861 299.99sec
fs_fs fs_fs elemental_blast_overload 120588 10012542 33377 2.79 511795 1416420 14.0 13.9 22.9% 0.0% 0.0% 0.0% 21.18sec 10012542 299.99sec
fs_fs fs_fs fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
fs_fs fs_fs flame_shock 188389 1543899 5147 2.24 97569 270696 11.2 11.2 23.1% 0.0% 0.0% 0.0% 27.79sec 19541938 299.99sec
fs_fs fs_fs flame_shock ticks -188389 17998038 59993 47.25 54053 149605 11.2 236.3 23.2% 0.0% 0.0% 0.0% 27.79sec 19541938 299.99sec
fs_fs fs_fs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
fs_fs fs_fs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
fs_fs fs_fs frost_shock 196840 36953173 123183 7.67 678890 1880357 38.4 38.4 23.7% 0.0% 0.0% 0.0% 7.54sec 36953173 299.99sec
fs_fs fs_fs icefury 210714 10551954 35175 1.93 771408 2136297 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.12sec 10551954 299.99sec
fs_fs fs_fs icefury_overload 219271 5619686 18733 1.23 648019 1794321 6.2 6.2 23.1% 0.0% 0.0% 0.0% 46.98sec 5619686 299.99sec
fs_fs fs_fs lava_burst 51505 46873594 156253 11.79 0 795004 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.03sec 46873594 299.99sec
fs_fs fs_fs lava_burst_overload 77451 24094433 80319 7.50 0 642244 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.86sec 24094433 299.99sec
fs_fs fs_fs volcanic_inferno 205533 2450042 8167 8.83 44714 91202 44.2 44.2 23.2% 0.0% 0.0% 0.0% 6.19sec 2450042 299.99sec
fs_fs fs_fs lightning_bolt 188196 36658891 122202 19.42 237433 659011 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.01sec 36658891 299.99sec
fs_fs fs_fs lightning_bolt_overload 45284 30515584 101724 18.91 202808 564281 94.5 94.5 33.2% 0.0% 0.0% 0.0% 3.76sec 30515584 299.99sec
fs_fs fs_fs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
fs_fs fs_fs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 299.99sec
fs_fs fs_fs spectral_blast 246442 5660101 18868 7.48 121869 248614 37.6 37.4 23.2% 0.0% 0.0% 0.0% 6.94sec 5660101 299.99sec
fs_fs fs_fs spectral_bolt 242571 12037909 40128 19.67 98655 201256 98.6 98.3 23.2% 0.0% 0.0% 0.0% 2.62sec 12037909 299.99sec
fs_fs fs_fs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 299.99sec
fs_fs fs_fs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.11sec 0 299.99sec
fs_fs fs_fs_primal_fire_elemental fire_blast 57984 16433385 143929 33.01 212302 424688 62.8 62.8 23.2% 0.0% 0.0% 0.0% 4.31sec 16433385 114.18sec
fs_fs fs_fs_greater_lightning_elemental lightning_blast 191726 7936073 186499 59.12 153612 307283 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.73sec 7936073 42.55sec
li_lvb li_lvb augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb earth_shock 8042 32721729 109068 3.30 1399934 3875112 16.5 16.5 23.6% 0.0% 0.0% 0.0% 17.50sec 32721729 300.01sec
li_lvb li_lvb elemental_blast 117014 18933945 63111 4.41 609149 1686493 22.1 22.0 23.2% 0.0% 0.0% 0.0% 13.75sec 18933945 300.01sec
li_lvb li_lvb elemental_blast_overload 120588 10006094 33352 2.78 511587 1417397 13.9 13.9 22.9% 0.0% 0.0% 0.0% 21.11sec 10006094 300.01sec
li_lvb li_lvb fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb flame_shock 188389 1455425 4851 2.24 91978 254871 11.2 11.2 23.2% 0.0% 0.0% 0.0% 27.76sec 18425004 300.01sec
li_lvb li_lvb flame_shock ticks -188389 16969579 56565 47.27 50942 141016 11.2 236.3 23.2% 0.0% 0.0% 0.0% 27.76sec 18425004 300.01sec
li_lvb li_lvb flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb frost_shock 196840 36925365 123080 7.68 678854 1879596 38.4 38.4 23.6% 0.0% 0.0% 0.0% 7.53sec 36925365 300.01sec
li_lvb li_lvb icefury 210714 10555379 35183 1.94 771230 2134316 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.11sec 10555379 300.01sec
li_lvb li_lvb icefury_overload 219271 5686113 18953 1.24 647700 1793093 6.2 6.2 23.7% 0.0% 0.0% 0.0% 47.01sec 5686113 300.01sec
li_lvb li_lvb lava_burst 51505 48131830 160434 11.79 0 816259 59.1 59.0 100.0% 0.0% 0.0% 0.0% 5.03sec 48131830 300.01sec
li_lvb li_lvb lava_burst_overload 77451 24779113 82594 7.51 0 659440 37.7 37.6 100.0% 0.0% 0.0% 0.0% 7.84sec 24779113 300.01sec
li_lvb li_lvb volcanic_inferno 205533 2434772 8116 8.77 44701 91194 43.9 43.9 23.2% 0.0% 0.0% 0.0% 6.16sec 2434772 300.01sec
li_lvb li_lvb lightning_bolt 188196 36695586 122314 19.42 237265 660564 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.01sec 36695586 300.01sec
li_lvb li_lvb lightning_bolt_overload 45284 30466623 101552 18.89 202667 563742 94.4 94.4 33.2% 0.0% 0.0% 0.0% 3.77sec 30466623 300.01sec
li_lvb li_lvb potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.01sec
li_lvb li_lvb spectral_blast 246442 5670732 18902 7.50 121869 248614 37.6 37.5 23.2% 0.0% 0.0% 0.0% 6.99sec 5670732 300.01sec
li_lvb li_lvb spectral_bolt 242571 12064010 40212 19.71 98655 201256 98.8 98.6 23.1% 0.0% 0.0% 0.0% 2.62sec 12064010 300.01sec
li_lvb li_lvb stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
li_lvb li_lvb totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.30sec 0 300.01sec
li_lvb li_lvb_primal_fire_elemental fire_blast 57984 16435131 143773 33.02 212275 424590 62.9 62.9 23.1% 0.0% 0.0% 0.0% 4.30sec 16435131 114.31sec
li_lvb li_lvb_greater_lightning_elemental lightning_blast 191726 7949573 186620 59.12 153573 307172 42.0 42.0 23.3% 0.0% 0.0% 0.0% 6.70sec 7949573 42.60sec
mb_lvs mb_lvs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs earth_shock 8042 32605632 108686 3.29 1399227 3877227 16.5 16.5 23.4% 0.0% 0.0% 0.0% 17.49sec 32605632 300.00sec
mb_lvs mb_lvs elemental_blast 117014 18884831 62950 4.41 609154 1686575 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.75sec 18884831 300.00sec
mb_lvs mb_lvs elemental_blast_overload 120588 10005951 33353 2.78 511778 1417148 14.0 13.9 22.9% 0.0% 0.0% 0.0% 21.06sec 10005951 300.00sec
mb_lvs mb_lvs fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs flame_shock 188389 1459399 4865 2.24 92014 255156 11.2 11.2 23.3% 0.0% 0.0% 0.0% 27.74sec 18415710 300.00sec
mb_lvs mb_lvs flame_shock ticks -188389 16956311 56521 47.23 50970 141073 11.2 236.1 23.1% 0.0% 0.0% 0.0% 27.74sec 18415710 300.00sec
mb_lvs mb_lvs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs frost_shock 196840 36924813 123084 7.67 678918 1879295 38.4 38.4 23.6% 0.0% 0.0% 0.0% 7.54sec 36924813 300.00sec
mb_lvs mb_lvs icefury 210714 10517218 35058 1.93 770860 2135331 9.7 9.7 23.2% 0.0% 0.0% 0.0% 32.12sec 10517218 300.00sec
mb_lvs mb_lvs icefury_overload 219271 5632102 18774 1.23 647690 1789936 6.2 6.2 23.3% 0.0% 0.0% 0.0% 46.99sec 5632102 300.00sec
mb_lvs mb_lvs lava_burst 51505 47888554 159630 11.78 0 813285 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.02sec 47888554 300.00sec
mb_lvs mb_lvs lava_burst_overload 77451 24410779 81370 7.50 0 651219 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.80sec 24410779 300.00sec
mb_lvs mb_lvs volcanic_inferno 205533 2424133 8081 8.74 44709 91205 43.7 43.7 23.2% 0.0% 0.0% 0.0% 6.13sec 2424133 300.00sec
mb_lvs mb_lvs lightning_bolt 188196 36660467 122202 19.42 237306 659495 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.01sec 36660467 300.00sec
mb_lvs mb_lvs lightning_bolt_overload 45284 30390150 101301 18.85 202699 563651 94.2 94.2 33.2% 0.0% 0.0% 0.0% 3.77sec 30390150 300.00sec
mb_lvs mb_lvs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.00sec
mb_lvs mb_lvs spectral_blast 246442 5652521 18842 7.48 121869 248614 37.5 37.4 23.1% 0.0% 0.0% 0.0% 6.94sec 5652521 300.00sec
mb_lvs mb_lvs spectral_bolt 242571 12011754 40039 19.63 98655 201256 98.4 98.1 23.1% 0.0% 0.0% 0.0% 2.62sec 12011754 300.00sec
mb_lvs mb_lvs stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.56sec 0 300.00sec
mb_lvs mb_lvs totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.14sec 0 300.00sec
mb_lvs mb_lvs_primal_fire_elemental fire_blast 57984 16386371 143748 32.98 212276 424606 62.7 62.7 23.2% 0.0% 0.0% 0.0% 4.31sec 16386371 113.99sec
mb_lvs mb_lvs_greater_lightning_elemental lightning_blast 191726 7927271 186376 59.11 153599 307231 41.9 41.9 23.2% 0.0% 0.0% 0.0% 6.72sec 7927271 42.53sec
tgt_eq tgt_eq augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq earth_shock 8042 32643477 108808 3.30 1398812 3877729 16.5 16.5 23.5% 0.0% 0.0% 0.0% 17.50sec 32643477 300.01sec
tgt_eq tgt_eq elemental_blast 117014 18901844 63004 4.41 609197 1686812 22.1 22.0 23.0% 0.0% 0.0% 0.0% 13.75sec 18901844 300.01sec
tgt_eq tgt_eq elemental_blast_overload 120588 9984932 33282 2.78 511828 1415968 13.9 13.9 22.8% 0.0% 0.0% 0.0% 21.11sec 9984932 300.01sec
tgt_eq tgt_eq fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq flame_shock 188389 1457027 4857 2.24 91964 255321 11.2 11.2 23.2% 0.0% 0.0% 0.0% 27.75sec 18431781 300.01sec
tgt_eq tgt_eq flame_shock ticks -188389 16974754 56583 47.25 50953 141057 11.2 236.2 23.2% 0.0% 0.0% 0.0% 27.75sec 18431781 300.01sec
tgt_eq tgt_eq flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq frost_shock 196840 36982232 123270 7.67 678957 1880580 38.4 38.4 23.7% 0.0% 0.0% 0.0% 7.54sec 36982232 300.01sec
tgt_eq tgt_eq icefury 210714 10555698 35184 1.94 771402 2136073 9.7 9.7 23.4% 0.0% 0.0% 0.0% 32.12sec 10555698 300.01sec
tgt_eq tgt_eq icefury_overload 219271 5646161 18820 1.24 647868 1793372 6.2 6.2 23.2% 0.0% 0.0% 0.0% 46.74sec 5646161 300.01sec
tgt_eq tgt_eq lava_burst 51505 46838580 156123 11.78 0 795052 59.1 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 46838580 300.01sec
tgt_eq tgt_eq lava_burst_overload 77451 24056240 80185 7.49 0 642223 37.6 37.5 100.0% 0.0% 0.0% 0.0% 7.83sec 24056240 300.01sec
tgt_eq tgt_eq volcanic_inferno 205533 2433069 8110 8.77 44708 91203 43.8 43.8 23.2% 0.0% 0.0% 0.0% 6.18sec 2433069 300.01sec
tgt_eq tgt_eq lightning_bolt 188196 36672678 122238 19.42 237198 660571 97.1 97.1 33.2% 0.0% 0.0% 0.0% 3.01sec 36672678 300.01sec
tgt_eq tgt_eq lightning_bolt_overload 45284 30490338 101631 18.88 202766 564675 94.4 94.4 33.2% 0.0% 0.0% 0.0% 3.77sec 30490338 300.01sec
tgt_eq tgt_eq potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.38sec 0 300.01sec
tgt_eq tgt_eq spectral_blast 246442 5660048 18866 7.49 121869 248614 37.6 37.4 23.1% 0.0% 0.0% 0.0% 6.98sec 5660048 300.01sec
tgt_eq tgt_eq spectral_bolt 242571 12018318 40060 19.65 98655 201256 98.5 98.3 23.1% 0.0% 0.0% 0.0% 2.62sec 12018318 300.01sec
tgt_eq tgt_eq stormkeeper 205495 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.01sec
tgt_eq tgt_eq totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 113.14sec 0 300.01sec
tgt_eq tgt_eq_primal_fire_elemental fire_blast 57984 16415281 143840 33.00 212303 424593 62.8 62.8 23.2% 0.0% 0.0% 0.0% 4.31sec 16415281 114.12sec
tgt_eq tgt_eq_greater_lightning_elemental lightning_blast 191726 7936708 186532 59.10 153612 307232 41.9 41.9 23.3% 0.0% 0.0% 0.0% 6.71sec 7936708 42.55sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1036231.1 1036231.1 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.04% 10.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.04%

Trigger Attempt Success

  • trigger_pct:97.51%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.22% 10.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.22%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.14% 10.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.23% 11.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.90% 10.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.89% 10.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.62% 11.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.62%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.39% 10.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.54% 8.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.03% 6.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1036231.10
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 112040
Mean 300.00
Minimum 239.93
Maximum 360.06
Spread ( max - min ) 120.12
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 36.3046
5th Percentile 245.20
95th Percentile 354.80
( 95th Percentile - 5th Percentile ) 109.60
Mean Distribution
Standard Deviation 0.1085
95.00% Confidence Intervall ( 299.79 - 300.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 563
0.1% Error 56256
0.1 Scale Factor Error with Delta=300 12
0.05 Scale Factor Error with Delta=300 46
0.01 Scale Factor Error with Delta=300 1126
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 112040
Mean 1058182.36
Minimum 902509.68
Maximum 1253659.86
Spread ( max - min ) 351150.17
Range [ ( max - min ) / 2 * 100% ] 16.59%
Standard Deviation 41883.5871
5th Percentile 991673.53
95th Percentile 1129434.39
( 95th Percentile - 5th Percentile ) 137760.86
Mean Distribution
Standard Deviation 125.1288
95.00% Confidence Intervall ( 1057937.12 - 1058427.61 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6019
0.1 Scale Factor Error with Delta=300 14975158
0.05 Scale Factor Error with Delta=300 59900632
0.01 Scale Factor Error with Delta=300 1497515784
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 112040
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 372716676 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.